p8z>O Kh@܀Ѐ.textЀ  .dataԀKh @.bssN),z(0pw$ @@p@p,\RlYp<YK$x (p$x ,\pl<@O$x OA),퇀,\񇀀Hp+Zp'Ppox@ p,\p=(p{U{MO(,|@p+@ p ,\p=(pwOL),z(pYpz3@@p@p(pw2+ZpO\),^h_,`k,lHp(4p% p p| p p pL II(lp , ,\&a(@C ,\p݂L II,\s,\<xO',P@@ p+@ p ,\p={{L IpI(hpwOj),pO),p,lL IIL(8 pbO)8 ,^@YpY, <O',P@@ p+@ p ,\p={,\&p,P@@ p+@ p ,\p={L IpppI,\B8 pL IpppIO)Ol,^Ol,<<xO',P@@ p+@ p ,\p={Ԅhp{L IpI(hpwOj),pO),p,lL IHLZpAA@A@@@@AOApZ@<@C$@<@_$@@$)@(Zpw@@dpYp<YGY@@AA@OT~@fPpYp{poYp<_YGY@@AA@OT~@fPpYp{fRp<Z$(,p`n~pz~pv~pRpRp`@@AA@OT~@`AAHHAOTAQpPp{o`@@AA@OT~@`AAHHAOTAQpPpRpn~p<w"zpvpz~pv~p$T~pYp<YGY@@AA@OT~@PpYp{poYp<_YGY@@AA@OT~@PpYp{`@@AA@OT~@`AAHHAOTAQpPp? 6@@AA@OT~@AAHHAOTAQpPpnpn~pRp\p\~phph~p~p~~p<< (,pw{"zpvpz~pv~p<$T~pt~pZ~pr~pp~p~p~pp~p~p~p~ptpnpZppppRp{L H IppHLpp,$ֈ@Yp,$ֈ@dpd@Y@p@AA(@CO*,@{ p,\z,\F=(@O,(PpO#(TpOPdpThp,\7O*O*O*O%*O*O*,ூO.*O.*O*O%*O.*O.*,TO4*O4*O7*O=*O4*O4*,&O4*O4*O7*O=*O4*O4*,OF*OF*OI*OO*OF*OF*,OX*Oc*Om*,௨,\OOw*,J!O,,\_@ p,\K(@CO*,@,\pl@,O(p@@,m,\XO$]O6O ,(hpw(lpw+A pw{(pw,l(Hpl(pp6(,pw-(p$,\s@AA+Aw,l(pp&(,p,\&a(@C,l(8 pw ,\&p,\XO$]O OP ,(@w{{ل@{L IpppI_,\@P]p(P]pw@{* ,\@T]p(T]pw@{@{L IpppIL(xpO(tp (Zpw{(ZpZ@Pp@{@pYpt@Y@+Pp"x@@<@YCZ@Y@tAYAQPpYp{քZ@Y@PpY@{L IppH<ZGZ@@AAHO+HX@{\zp(dp,؉@pApT1pX1p@{L H G IpG0Lp(Zpw$v1<xG$v1(|pC|pxYpY@YHp@AAAA@@Yp(YpG$v1phpx@Y@<@hK$s1h@Y@@AA@Z@PAApAp(pw O.-p(tph@Y@@AA@t@Pp(|pO3@+Pp),$ֈ<|@C O.-p{G|GGpphdp(dpC$>1d@@AA@Z@Pp(pw O.-p(|pO?@+Pp5,$ֈ<|@C O.-p{d@@AA@Z@PG|GGp<$0lp(p,p p$p,(@?T1 pX1$p,g(@T1(pX1,p{ p$p(, $,(@Clp{lp{,@lp(pw (lpC{](p (lpO{Pd@Y@@AA@Z@dAAHHAZAQPp(tp#d@Y@@AA@t@dAAHHAtAQPpYdpzd@Y@@AA@Z@Pp(tpd@Y@@AA@t@PphpzzL H G IpppI L(tpw O.-tp(xpw O.-xp(|pw O.-|p(pw O.-pt@+Ppw$x@+Ppw|@+Ppw@+Ppw$2Z,@Yp(Ypw O.-YpY,$ֈ@dp<d @$p3t@+PpYt,й(@G @$p3x@+PpYx,й(@K @$p3|@+PpY|,й(@O @$p3@+PpY,й(@C @$p3<G <G{BZ,@hp(hpC @$p3<O<hK @$p3<O <hG@{}(p O\1Z ,a(@@{Ypdp($pJ< dCDd@@AA@$@(Ppw{/d@@AA@$@PZ ,(@@{ dp{@{L IpppHLO6dplpp<tO <$tG{ @$!5<xO <$xG{ @$!5Z@?+PwZp{Z@?-PwlpZppZ@? PZ@?0P{Zp{pZ@+Ppw$4Z@PYpY@!GAA+AY@@,`ֈ@Yp?/Y_?9YWY@p@HoHHhp{,?o@Y_?oZYWY@p@HoHHhp{ @$!5@t@p@HhHHp(pCO1@$!5pZpzL(pw O1@{kOC7dpd@Ppdp(p;@PpYp{YpY@@AA@O>@2PpYpY@@AA@O>@oKPpYpY@@AA@O>@onPpYpY@@AA@O>@_PpYpY@@AA@O>@_PpYpY@@AA@O>@_PpYpY@@AA@O>@_,PpYpY@@AA@O>@_XPpYpY@@AA@O>@_PpYpY@@AA@O>@_PpYpY@@AA@O>@_` PpYpY@@AA@O>@_PpYpY@@AA@O>@_%PpYpY@@AA@O>@_KPpYpY@@AA@O>@OPpYpYHHH>pO>@{L H II L(@8pC8@@@Yp{<@8_TO8,@dp(dpC @$(\8@@@YpY@<@C$\@<@_$\@@$(7p5,\l@hp(Hpw5Z,@hp(hpC(@=p@{@$s{ h@$s(ZpGfI@@@,@Yp(Ypw{(YpO d@$s<Mw$( :p :p=@$s{{@$s{Ov<,@$8pZ,𸈀@hpO=,(@Yp{I@@@,@Yp,\?(YpOd@{B(lp+Opwd@OG@Ppdpd@OG@YAOCAQPplp{Ypdpz(lp+Opwd@OG@PpdpOGdOK,񈀄@p@{L IpppIL,\@YpO=ZY@+Pp O=@{ O:@@Y,{L IppIoDL(Lpw$}(LpwOLOM,J!(Zpw OMZp(tpw OMtp(xpw OMxp(Lpw,L ,p@AALp(AC Lp{iLI@$@@,Hو(@wOI@ @@Z ,4It,4I@ @@,͈LI$,<$@{{L II,\@,@, @{L IILObYpdpbpZd_@@Y,NY@+PpY@? PW Y@o_PpYp{L II(@Kp{n(l_@Aw@@(Np$@($pC@{L H IpI,L(p(Zpw @$ԏZ,$ֈ@$p($pG @$ԏZ p< $w O4N,й(@w @$ԏ @?o~Pw. ,8@ p( pw OM p @+PpwZ p I,tو@$p($pC @$ԏd@O@>_@@w(p((p (pw{d@O@>_@@{O ,ֈ@$p($pC @{2{0MpOj _,4M@p(@C@{L IpppILhp(Zpw @$ÑZ,$ֈ@dp< dwZO4N,й(@w @$ÑZlpl@?o~Pw(l,6@lp(lpw OMlpl@+PpwZlplZplp(pwZ,;(@ @$Ñd@@@,\@lp(lpwOLO>N,x@$ÑlZ,dYp(YpO"Y@l@p@AA?/Qwhp{Yp{(hpz(YpOuY@l@p@AAQpl@+PpZl,=;(@wNl,$ֈ@Yp(YpO.Y@l@p@AA?/QwY@l@p@AAQp{Yp{(Ypwl@Pp{{l@Y@.PpYpl@Y@Ppl@+PpwlOVN,l,ֈ@dp(dpC{l,(dpC@{@{L IppIL(4pYp{Z,Tڈ@YpY@{L IIZt_,L IpG_(Lhplppp(tpw$<(Zpw OMZpZYpY@?o~Pw(Y,4@Yp(Ypw OMYpY@+PpYZppHZO4N,й(@wHHp(pw/(|pw*ZI@@@,I@@@d_,{k(pw<|wI@@@Z_,{G(pw*Z,(@I@@@OXNZ,{I@@@Z_,4pIGGGpIG_GGp p$p@+Ppl<_$Gc p< O'@+Pp@?/P p{䀩 p{@?/Pw p@AQPppp$p{@PpI@@@I@_@@_,4(xp (pw{tI@@@,4$u(@ , d,0,0O4N,p(@C @$ל,0h,$<@ @$ל,0h,$<@ @$לh,0OwN,D@lp(lpw>,\u@,`@p(p@ A+Qpw {lp{ @ lpl@@p@p@+Pp@p?/Pwp{,\=lO}Nt,͈, {<Mw @$לh,0Z@@AA@OdM@PpdOM,TZAAHHAO0MA@Qp<Zwr((piZ@@AA@O0M@PA @@,@@AAp@w>Bw @${ @$bpZ_Ob,[%(@ ObYpfpt_Of,6%(@ OfdpYd,й(@w @$Y,M$(@ @$d,8$(@o`pd,$ֈ@hpd@h@p@AA?/Q h@Of@/Pph@Of@PphpYI@_`@@,hOf@@`,,و@GGpdp40p ,px@p(@ <@m{}@O@>_@@w _@p(dpZ@@,@Dp(xpC@{G(hpw@{>ZI@,@@,hڈ(@Yp{Yp{@<4$K@@Yp{YpY@{L H G IppG LYpZ,$ֈ@HLS,$ֈHA@AAGGGplp<@SlC@l@@AA@t@(Pp)l@@AA@t@P,l@@AA@t@Pplp{@Sp,\@Yp(Ypw @$MYOPSLSZ,Y,lpOwdpp(|p,\뀀@H{/bp(bpKb@PHbp{ ,\.΄@HH@@p<@w$%p? ? $d@PpOwdpd,<@w$d,@p(Np (pwzR(Np (pz@d,$ֈ@p@@@,\@hp(hpw{BhOw,l@@AA@t@hPplp_@Aw@{@@4p{!tOgN,x׈4p(@w4p{:tO`\,tو<@@d\AOA>_@Aw@{@@4p(NpwdS@?.Pw Np(Npw:`S@?.Pw,`S@@?/P`S@@?.P Np(Npp(Npwp(NpG$(4p$xpx@Ppt@?/Pw tpp{=xGGGppDp_@Aw@{@@4p{4p{:tO`\,tو<@@d\AOA>_@Aw@{@@4p(NpO1(4p+dS@?*PwdS@@+Ppw t4,tp(4pZ@{ `S@@p(4p*(Npw!(hSpO(8pw(_@Aw@{@@tp(Np (tpw{(Np(tpw{$ŀpZ@?.PwZ@@?/PwZp{ xp( xpCxp$ŀZ,$ֈ@HHHYpx@Y@p@AtAXS@\S@<@A_ xp{zxZ,(tp?Y@x@p@AA?/Q'Y@x@p@AA/Qpx@Y@PpYpx@xPpxpYxpxpL H II_LL<SOS@$ǀ,\u@SpOS,D@AADp(AoI@oD@@D_,4I@oD@@, @AAHp(A8H@<Sw)OSI@oD@@o@,4OS@$ǀ,\@AADp(ASIDo@,4I, @AAHp(A+H@<SwOSI@oD@@o@,4S,`@AAHp(AwSpSp@{#OSH@Po@,4OS@{L IpppI LZ@?o~P Z@$rȀOSZ,й(@wOT@$rȀ$ǀZ,$ֈ@hpdpu(@OV,z_,4͈,\=OoNOWO}NZ,͈OoN,|_,4͈@{L IpppILMp(xp9<@8O0@8,8@8,8@8,0,\=Zt,̑@Yp(YpCL IpppI$L(< p @$`ˀ,\<͈@AAYp(A$ʀOoNp,\>u(@ , OwN,D@dp(dpw>,\u@,`@p(p@ A+Qpw {dp{ @ dpd@@hp@lpl@+Ppl@lp?/Pwlhp{,\=(Zp Z@+Ppw{dhOW,͈{dhO}NZ,͈, $[ˀ_@Aw@{@{L IpppI(4p@{@{L IIbp8MZ,안(@@{@{L IppG_LLIGGG,p0p4p8p<p@pZYp(Ypw @$ ҀY@+Ppw @$ Ҁ(xpw @$ ҀxZt,4@ Wpx$Wp(WptdpY@?o~Pw2Y,{@Dp(Dpw OMDpD@+PpDYppY@+Pp2Y@?.Pw$Y@@?/PwYpY@?/PwYp{{{{ɄY@+Ppw @$ ҀY@?/Pw+xYd,4x,$ֈ@<p@p$΀,\˄@AAHp(AgxHd,4@<px@<@/Pp<p<dpY,$ֈ@AA@p@@$(p&(p&p{( p(p{<w oNp{+p`p<lGppO@$1<@0@{oB@@p<lGp4pO@$1(8p7(4p3p{@p@AA0pAp{ p<lG2pppXpdp|pO@$1(p H{HHG(pp lGpGF(Xp TFpFE(dp `E(|pE@x@ @_@{ E@ @_@@p< lGpO@$1(dp@ @{!@@p< lGoPpO@$1<lOZAAQ@o@_@{ @@YpY@(YpC @@p,X@ppp<lOGZ@@PApA@o@@G_GGp<lOZ@@PGo@GGp{ p(p7p<C)@@,CAO^A@Qpp{<lOZAAQ@_@{ @@p+p?W{ p<lOZAAQ@{#@@Yp< YO <>YO{$O{_{?o__?o~_{4p0p{ 4pphp\ptp< p dp< lG$Z@ @PApA@o@@G_GGYp@YAlAp(A(pp@@tp@YATAp(A(Xp@@\p@YA`Ap(A(dp@@hp@YAxAp(A(|p@@p<0@YAAp(A(p(p@@pp dpZ@d@PA_AA@@+@ ;I@@@Z_,4ppODO~I@@@샐,pOD,$ֈ@􃐀pp(p pI@@@,@p(pG@{OppO0O,8pltpO7,pp,\{L IpppH LZ@PApA@o@@A_AA@Z@p@AAQpZHHHdpd,`(@w$J<,\\@Yp(p_hp<hGWh@@AA@O@P,<@O2(Hp$(7pw(ppY,@{Shp{Y, \,,d(Hp$(7pw(ppY,@{{@{L H IpHLHp(Zpw @$=Z@+Ppw @$=pO0YpZ@+PpY@ZAQPpZpYp{pYAtHX@@QptpYp+@{O0,(@O8tpppppHp,\ھ{{ Hp@{L H IpppHLZ@PApA@o@@H_HHYpZpZHYHHp@PppZ,\@hph@<_@C$B_@<_ @_$B@@$,\@pp@$B,\@AApAp@$B,\@AApAp@$B,\@AApAp@$B,\@AApAp@$B,\@AApAp@$B,\@AApAp@$B,\@AApAp@$B,\@AApAp@$B,\@pp@$B,\@ppdp@$B,\@ppВp@$B(0p(4p @$B,\@hp(Hp{ @@+@w2{(Hpw{ @@+@w{<h <h{ @$B(hpw @p<hw @php@$B,\@p@$B,\@ p@$B,\@p@$B,\@p@$B,\@p@$B,\@p@$B,\@lp<lG"(lpOlpp@$B{'@?oBPwpp@$B@$B,\@AApAp<_@#O _@#pdt,ꐁ@hp(hp@{&d,@Yp(YpC@{d4p@{L H G IpItO𘐀,{L IpppGLthph@@AA@Ot@Pdph,jh,@AAYp(ACPpoYhO𘐀,@lpPp(lpCl@{ZO$ f+ptp{ lpp ppoYOpt,$ֈ@Opt,@hp(hpC h@$Uh#ZO񘐀,pl p{'oYZO𘐀,@hp(hpC h@$Uhp(Hp,(7pw#(pp%4O,@$Uh{ @$UhYAA@A@@@@ALA@p<@OHp@$Uh,\ƑYAA@A@@@@ALA< wy(phZ,kp(Hp,(7pw#(pp%4O,YAA@A@@@@ALA@$Uh{ @$Uh(pO,\plZAAHHAO,A@QpYAA@A@@@@ALAYAA@A@@@@ALA ,a@hpp(Hp,(7pw#(pp%4O,oSZYAA@A@@@@ALAYAA@A@@@@ALA ,qYAA@A@@@@ALA@{L H IILtplp(Hp$(7pw(pp Z,Z,ۀoE4]\,@YpTZoP,4DdpDpp,\ |,ԲdDp(p @@p@pp<H$j(Pp (Ppw$j(Xpw$j<G(pw$jlp(Hp((7pw(ppO,pqpphp< G$ o,\@p(pwOdp@$)rI@@@O# ,I@ @@,$ֈ@YpcH HHipY@@@,\A@Qp@(PpwO(dp@$)r@PI@@@,@p(\pw \pp<$G$o,\@p(pwODdp@$)rI@@@O`$,I@ @@,$ֈ@YpcH HHipY@@@,\A@Qp@(PpwOedp@$)r@PI@@@,@p(\pw \p{ @ppP ,$ֈ@Yp@@<@YOOdp@$)r,\@p(pwOdp@$)rY@@@,\A@Qp@(PpwOdp@$)r@Pdpd@oFPpdp䀀@pOL,4@hp(hpC @$N(p/@Ap(@C_@ @LpĠp,\a(@C @$NYp(pw${. p*p${@Y@AA\@Y@Pp\,$ֈ@lpoA4l\,Y{{@{L H IpHL<w Ox@{sZdpd@dp?oNP Oߠ@{X{Qd@PAAYp? A_@Yp_YpY@<@WY@@AAHOHX@{ O@@dpd@{L H IpppG LZ@?oNPwZ,Z@ࠐp@$ҝ<0$Z@?1P$ZGGGhph@PApA@o@@G_GGYphpdpY@Yp(@O.dAA@A@@@@AoAh@PHpAGHGGdphp{(dpO dp(pO,̀(@C@{Oߠࠐp@{L H G IpGoHL apOl^dp(pw(p+vp OvdpOxt@(Ppw@$$Ɂ(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp{ lp$(p( pw  pp(pw$ʁ(p$ʁO,^h,\D(Ppw@$$ʁ(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$Ḿ(Hp{ @@+@$ˁ{(Hpw{ @@+@$ˁ{O,^h,\S(Ppw@$$ˁ(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$Ḿ,fI(@K$É,\(Ppw@$$Ć(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp{ lp$(pw$́(pw}O,^h,~(@C @$,\6pHpOpT p0p4pL(pP p lp$́,fI(@K$́,\D(Ppw@$$́(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp{ lp$(pw$<΁(pw}O,^h,~(@C @$,\6pHpOpT p0p4pL(pP p lp$ρ,fI@AA칐p(AK$΁,\(Ppw@$$΁(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp{$(칐pw lp{,\Nblp$(pw$ρ(pw}O,^h,~(@C @$,\6pHpOpT p0p4pL(pP p lp$Ё,fI@AA칐p(AK$wЁ,\h(Ppw@$$uЁ(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp{(칐pw lp{ ,\Nb$Xh^pd^Oۀ,,ۀ,ۀX@+Ppw$ҁX@P@ p(pw$с(p$с?oI@ w$с?oL@ w$с?oH@ yO,^h,~(@C @$,\6pHpOpT p0p4pL(pP p lp{NpHp(pw'(pG,X@pp lp$ҁOƨ,^h,\,(Ppw@$$ҁ(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$(pw$JӁ(pw}O,^h,~(@C @$,\6pHpOpT p0p4pL(pP p lp$<ց(Hp @@+@$;ԁ{(Hpw @@+@$;ԁ{O⨐,^h,\(Ppw@$$5ԁ(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$<ց(< pw$ԁO,^h,\(Ppw@$$ԁ(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$<ցXh^pd^Oۀ,,ۀppXOp,X<(@FHp(pw'(pG,X@plp$<ցO,^h,\(Ppw@$$<ց(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$,\7@p<O@$$O+,^h,\(Ppw@$$ׁ(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$<%Y<9YOO,^h,\ (Ppw@$$ׁ(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$,\(3@p<O@$$(Hps @@+@$؁{(Hpws @@+@$؁{Om,^h,\(Ppw@$$؁(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$<݁pX@@@,H;@칐p(, p(HOX@@@Op, (칐p$ځO,^h,\(Ppw@$$ف(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$<݁<칐$Z܁(Hp @@+@$ہ{(Hpw @@+@$ہ{O,^h,\(Ppw@$$ځ(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$T܁ p< G+ @@AA@O@P,<@O{ p{Ӏp< G0 @@AA@O@P,/(@lp$T܁,\\@p(pw Opp@A+Qp@@pp,,dpp,\(Ppw@$$T܁(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$<݁,\\@p(pw Opp@A+Qp@@pp,,dpp,\(Ppw@$$<݁(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$(Hps @@+@$3ށ{(Hpws @@+@$3ށ{Om,^h,\(Ppw@$$-ށ(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$ ߁,\\@,ۀ<@O\,,dpp{,\Nbpp,\(Ppw@$$ ߁(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$(Hp @@+@${(Hpw @@+@${O,^h,\(Ppw@$$߁(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$X⁀(, p(HOЩX@@@Op, (Hps @@+@$Z၀{(Hpws @@+@$Z၀{X@@@I@ @@,JX@@@ ,й(@w$Z၀O۩,^h,\(Ppw@$$Z၀(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp< l$X⁀X@@@,5@AA$p(AOlp$X⁀($pCO驐,^h{O,^h,\(Ppw@$$X⁀(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$(Hp{ @@+@$O぀{(Hpw{ @@+@$O぀{O ,^h,\(Ppw@$$I぀(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$s恀(, p(HO$X@@@Op, (Hps @@+@$䁀{(Hpws @@+@$䁀{X@@@I@$@@,JX@@@$,й(@w$䁀O۩,^h,\7(Ppw@$$䁀(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$u偀X@@@,J̀(@w$u偀O2,^h,\h(Ppw@$$u偀(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp< l$s恀X@@@,.:@AA p(AOlp$s恀( pCOC,^h{OR,^h,\j(Ppw@$$s恀(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$(, p"HO`OpOp, (Hp @@+@$灀{(Hpw @@+@$灀{On,^h,\P(Ppw@$$灀(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp{H,\Nb(Hp((7pw(ppOp,pp@$$(, p"HO~OpOp, (Hpo @@+@$聀{(Hpwo @@+@$聀{O,^h,\(Ppw@$$聀(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp{H,\Nb(Hp((7pw(ppOp,,l$(, p"HOOpOp, (Hp @@+@$Wꁀ{(Hpw @@+@$Wꁀ{O,^h,\(Ppw@$$Qꁀ(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$ꁀ,\Nbpp_,`k(Hp ,\LJ(Hp((7pw(ppOp,,(0p ,\{,\}$$(, p"HOOpOp, ,.(@lp$끀O,^h,\ (Ppw@$$끀(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$,\B@p<O@$$,\%>@p<O@$$(, p(HO̪X@@@Op, (Hp @@+@$H큀{(Hpw @@+@$H큀{Oת,^h,\(Ppw@$$B큀(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$X@@@,"=(@pp,\Nb{O몐,^h,\(Ppw@$$(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$(Hp @@+@${(Hpw @@+@${O,^h,\(Ppw@$$ (XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$Q(, p(HOX@@@Op, (Hps @@+@$j{(Hpws @@+@$j{X@@@I@$@@,JX@@@$,й(@w$jO۩,^h,\s(Ppw@$$j(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp< l$Q񁀀pX@@@,/(@lp$Q񁀠O,^h,\(Ppw@$$Q(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$O$,^h,\(Ppw@$$(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$O?,^h,\*(Ppw@$$(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$(Hp @@+@${(Hpw @@+@${OZ,^h,\9(Ppw@$$(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$7X@@P칐p@(칐p < 칐{@@칐p(, p7HOp(칐pw X@{ Op@@Op, (칐p$(Hps @@+@${(Hpws @@+@${O۩,^h,\(Ppw@$$(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$7(< p 칐p{I(칐pKOp,X<@H{KX@@@,X<@HH칐p(칐plp$7O},^h,\(Ppw@$$7(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$(, p(HOX@@@Op, (Hp @@+@$]{(Hpw @@+@$]{O,^h,\(Ppw@$$W(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$4KX@@@,X<(@lp$4O,^h,\(Ppw@$$4(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$,\V)@p<O@$$(xphppHpD칐pDp,\ ,Բ,\pl@p칐Dpp@$$}(opw$0(Hp @@+@${(Hpw @@+@${Oë,^h,\(Ppw@$$(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp{bppHpD칐pDp,\ ,Բ,\pl@p칐Dpp@${OD칐pDp,\ ,Բ,\pl@p칐Dpp@$$Oѫ,^h,\(Ppw@$$.(XpXp@${i,~(@C @$,\6pHpOpT p0p4pL(pP p lp$(`pG,\&a(@C<_,`k`p,G,Բpp@${pp@$$,\/!@p<O@$$p(p$>(0pwxOYpOdp(Ypw"+Op_,񇀇Op(dpw"+Op_,񇀇Op(dp (Ypw{Oȶ,퇀?ox@ ?ov@ {W(0pw&+Zp+Zp,hp+Zp+Zpw,6-Zp{{+Zp!+Zp,6-Zplp+ZpH+Zpw>,(@w.?os@ "pp(HpO޶,z{(@pw ,\_,\pLp(p+Zp"+Zp(lpw,6-Zp(pw$@(pw$@(pw{(0pwr(Ypw(+Op_,񇀇Op{Yp(dpw(+Op_,񇀇Op{dp(dp (Ypw{O,퇀\#ppp(ppwHp4p<0O0p0pL(pP p<Opppp,pL IH_L@ hpip0pppdp`php(Hpw$]B,\&a(@K$]B(`p,Gpp$\I?og@ wX(P pOP @?oLP"P @?oFPP @?oXP{ pp{O,z$\I(HpI(pC@(,pw7(Hp((7pw(pp O*,$\IYpO\I(,H@(@C7(Hp((7pw(pp OL,$\I@4p{(XpO{,z{}\,$ֈ@p\t,"(@Q(XpO{,z{6tGGGpO`,z,>4p\@,@?:P\@,@?=P{\@,@Pp{,p{Z\tI@ @@,A@hph@<@#<@G <@$<@a$$t4p@@+@8(XpO{,zO\,z@$@$(dp2Yp@hpx,zGGGDp\@+PpDpZt\OȻOȻD,׸(dpO<OZ,z\@+Ppw?<dwO@PAA,z{ <dOO,@,zOɻlT,zOK,{ O,z4p@{,)@pzUL H G IppILZYppY@+PpY@\A?QPYp{Y@+Pp YAQ@{@{L IppG_LYppp@AAdp(Awz:{t,z< @@AAppA@$f݂pOp,$ֈ@,"(@$܂(pp8OZ(< pw (pw{ O9@{ O@@,z{-(< pw (pw{(7pwOn,z< @@AAppA@$f݂OpLI,h΂@dp(ppCOYAA@A@@@@AOAQ(dp O9@{ O@@,z{8(dp3(7pw*OYAA@A@@@@AOAQ,zd@@AAppA@{L IpppF8L(op+tpw {$߂opOt,냀@YpI@@@,\d@,4I@@@,냀@dpOt0p0@ @Pp0@@Pp0@ @@,􉈀@H0@ @@,􉈀@G0@@@,􉈀HA_AGHGHHHHAAF@FFhp0@ @:Pp0@@:PpIFFF0p0@ @Pp0@@Pp0@ @@,􉈀@H0@ @@,􉈀@G0@@@,􉈀HA_AGHGHHHHAAF@FFlpd@Y@p@AOQAl@h@pAF@FFlp),@AAYp(AC<_,G6,FoFFppppAA{I<_,w7,F_lFFppppAA{ A_ A@?@_$U0O p((p$o/OOp(,pK!<1,G,@@A@AAA@A@{s<_,O1<_,G),FoFFpAAAA@A@{<<_,w*,F_lFFpAAAA@A@{ @_ @@@A @A@$P0OOp(,pK2<1,G,,AA pA p  pA A$:0<_,O><_,G6,FoFF$p$(p$(p((pA(A{I<_,w7,F_lFF,p,0p,0p00pA0A{ A_ AAA4p @4@P@{ OX,@@Ж,@AAdp(AC d@$mz,\ԯ@AAlp(AC l@$mz((pw$1OO8p(,pK!<1,G,@@A@AAA8@A@{s<_,O1<_,G),FoFF<p<A<AAA8@A@{<<_,w*,F_lFF@p@A@AAA8@A@{ 8@_ @gpOODp(,pK!<1,G,@@A@AAAD@A@{s<_,O1<_,G),FoFFHpHAHAAAD@A@{<<_,w*,F_lFFLpLALAAAD@A@{ D@_ @gp$A3OOPp(,pK!<1,G,@@A@AAAP@A@{s<_,O1<_,G),FoFFTpTATAAAP@A@{<<_,w*,F_lFFXpXAXAAAP@A@{ P@_ @gpOO\p(,pK!<1,G,@@A@AAA\@A@{s<_,O1<_,G),FoFF`p`A`AAA\@A@{<<_,w*,F_lFFdpdAdAAA\@A@{ \@_ @gp$?OX((p OC,@{ O`,@@((pw$ 4OOhp(,pK!<1,G,@@A@AAAh@A@{s<_,O1<_,G),FoFFlplAlAAAh@A@{<<_,w*,F_lFFpppApAAAh@A@{ h@_ @P@$4OOtp(,pK2<1,G,,AAxpAxpxxptAxA$4<_,O><_,G6,FoFF|p|p|pptAA{I<_,w7,F_lFFpppptAA{ tA_ A@?@_$6Op((pw$5OOp(,pK!<1,G,@@A@AAA@A@{s<_,O1<_,G),FoFFpAAAA@A@{<<_,w*,F_lFFpAAAA@A@{ @_ @P@@A@A@$6OOp(,pK2<1,G,,AApAppAA$6<_,O><_,G6,FoFFppppAA{I<_,w7,F_lFFppppAA{ A_ AAAp@@P@{ OX,@@Ж,@AAdp(AC d@$mzOX((pw OC,@{ O`,@@((p$7OOp(,pK!<1,G,@@A@AAA@A@{s<_,O1<_,G),FoFFpAAAA@A@{<<_,w*,F_lFFpAAAA@A@{ @_ @@$8OOp(,pK2<1,G,,AApAppAA$~8<_,O><_,G6,FoFFppppAA{I<_,w7,F_lFFppppAA{ A_ A@?@_$B:Op((p$\9OOp(,pK!<1,G,@@A@AAA@A@{s<_,O1<_,G),FoFFpAAAA@A@{<<_,w*,F_lFFpAAAA@A@{ @_ @@@A@A@$=:OOp(,pK2<1,G,,AApAppAA$':<_,O><_,G6,FoFFppppAA{I<_,w7,F_lFFppppAA{ A_ AAAp@@P@{ OX,@@Ж,@AAhp(AC h@$mz,\ԯ@AAlp(AC l@$mz((pw$-=OOp(,pK!<1,G,@@A@AAA@A@{s<_,O1<_,G),FoFF p A AAA@A@{<<_,w*,F_lFFpAAAA@A@{ @_ @gPpOOp(,pK!<1,G,@@A@AAA@A@{s<_,O1<_,G),FoFFpAAAA@A@{<<_,w*,F_lFFpAAAA@A@{ @_ @gpOO p(,pK!<1,G,@@A@AAA @A@{s<_,O1<_,G),FoFF$p$A$AAA @A@{<<_,w*,F_lFF(p(A(AAA @A@{ @_ @kpOO,p(,pK!<1,G,@@A@AAA,@A@{s<_,O1<_,G),FoFF0p0A0AAA,@A@{<<_,w*,F_lFF4p4A4AAA,@A@{ ,@_ @kp$?OO8p(,pK!<1,G,@@A@AAA8@A@{s<_,O1<_,G),FoFF<p<A<AAA8@A@{<<_,w*,F_lFF@p@A@AAA8@A@{ 8@_ @gpOODp(,pK!<1,G,@@A@AAAD@A@{s<_,O1<_,G),FoFFHpHAHAAAD@A@{<<_,w*,F_lFFLpLALAAAD@A@{ D@_ @gpOOPp(,pK!<1,G,@@A@AAAP@A@{s<_,O1<_,G),FoFFTpTATAAAP@A@{<<_,w*,F_lFFXpXAXAAAP@A@{ P@_ @kpOO\p(,pK!<1,G,@@A@AAA\@A@{s<_,O1<_,G),FoFF`p`A`AAA\@A@{<<_,w*,F_lFFdpdAdAAA\@A@{ \@_ @kppp@$mzOP X Ou,O𐀠Ж,@AAlp(AC l@$mzl@<@C$H@<@_$H@@$9O0O,OЖ,@AAdp(AC d@$mz,\ԯ@AAhp(AC h@$mzdppp@$mzO,@AAppA@$mzO,@AAppA@$mzO,O𐀄I@@@Ж,@AAhp(AC h@$mz(p,p(p@+Ppw{ppp@$mz{^,$ֈ@AAA,\@AAp(A&,pp@$mz{pp@$mzO0 O𐀠OЖ,@AAdp(AC d@$mz<dwvOD  O𐀠OЖ,@AAdp(AC d@$mz,\ԯ@AAhp(AC h@$mzdppp@$mz$C<dwrOD  O𐀠OЖ,@AAdp(AC d@$mz,\ԯ@AAhp(AC h@$mzdppp@$mz{6,\ԯ@AAhp(AC h@$mzdppp@$mzO O𐀠OЖ,@AAlp(AC l@$mz,\ԯ@AAhp(AC h@$mzlppp@$mzO O𐀠OЖ,@AAlp(AC l@$mz,\ԯ@AAhp(AC h@$mz<Ĝ<Ĝw<Ȝw{pp@$mzlppp@$mzOXO𐀠OЖ,@AAdp(AC d@$mz,\ԯ@AAhp(AC h@$mzgOpgOpgOpgOppp@$mzOXO,O,Ж,@AAdp(AC d@$mzOXO,O,Ж,@AAhp(AC h@$mz,\ԯ@AAlp(AC l@$mzkZpgZpkZpgZppp@$mzOXOO,Ж,@AAdp(AC d@$mzOXO,O,Ж,@AAhp(AC h@$mz,\ԯ@AAlp(AC l@$mzgVpkVpgVpkVppp@$mzOO𐀠O\Ж,@AAdp(AC d@$mzO O𐀠OЖ,@AAlp(AC l@$mz,\ԯ@AAhp(AC h@$mzd@<@K<@<@W4@@$x9lp{ lp{lp{ lp{pp@$mzO O𐀠OЖ,@AAlp(AC l@$mz,\ԯ@AAhp(AC h@$mz(0p((pO,,zpp@$mzlpEppp@$mzO-O𐀄I@@@Ж,@AAhp(AC h@$mz<@w$MK<@G(@w$J$M<@w$K<@w$L$M< @w$L< @G<@w$aL< @w$K$M< @w$L<_l@$M,\ԯ@AAhp(AC h@$mz@@,mpp@$mzOi-O- I@@@Ж,f@AAhp(AC h@$mz<d$<dO-,zpp@$mz,\ԯ@AAhp(AC h@$mz<dw o$p{<dw _$ppp@$mzO-Oz I@@@Ж,f@AAhp(AC h@$mz,\ԯ@AAhp(AC h@$mzd,b@AAppA@$mzO̖,@AAppA@$mzOp,@AAppA@$mzI@@@,@AAdp(AC d@$mzh,Ђh됀p(hp O0f@{@@Жppp@$mzO-O- I@@@Ж,f@hpOhdh_,$mzO-O. I@@@Ж,f@hpOddh_,$mzO,$mzOԜ,$mz@$mzZ@<@w$N<@G <@1$N<4@$N,@AAppA@$mzOT𐀠𐀠O𐀠O𐀠Ж,@AAhp(AC h@$mz{W<hw7O,@dp(dpC d@$mz{pp@$mz{,\ԯ@AAdp(AC d@$mz(0p((4pO,,zpp@$mzh@<@,<@G(@ {W<@9{Pppp@$mzO.,zpp@$mzppp@$mz@$mz{^OD.On. I@@@Ж,f@hp(dpCdpO dh_,@AAppA@$mz{Z@<@Z<@G<@[<@w$O$aQ<@G (@$m<@A$mO8,@AAppA@$mzO)6,z@$mzO/O𐀠 I@ @@Ж,f@AAdp(AC d@$mz,\ԯ@AAdp(AC d@$mz< lO <>lO{O\O:,й(@O:O\,z{O&;,z{c(pwhp{0,\s@AAYp(AKYHHHhp{,\&a@hphhp(tpwhp(hpO^;O\,z(hpw(ZpwC<w:(Hpw{/(Zp O;@{ O;@@,ق@dp(X p+Zpw,6-{(X pw+Zp ,6-,\Z~@Yp+Zpw$d+Zpw$d(<pwx(Dpwo,\&a(@KdOR,zOCR,zOR,zOR,zOR,zOS,zO+S,zhDp(pp,\&a(@C,l@@,m,\X(YpG$-<Ĝ <Ĝ$-(Ȝpw$-|OXSк,֮<@wIOXS0pAA@A@@@@AA@@@,OXS,l(Ĝpw$-H<ĜwH(LpwH@@+@w{{Ĝp$-Dhp(Dpw(< p @$RZ,(@GOtSZ,z@$R{*Z,~(@wOSZ,z@$R pO\I@ @@(,H@(@COSO\,z@$R( p @{@@4p(|pE< @{@@p4,S(@COS,z@$R{34,PP(@COS,z@$R@(Hp(,p <{(Hpw(pw{@@p(pO~,@Ypplp$p<$G$䐃(dp$䐃hp(pOS,z$吃(|p,\뀀@H{1bp(bpKb@PHbp{ ,\d@HH$p<$COS,z$吃{!<$O0p<$p{ <$wdp(|pw$U<$w$萃'@@,C@AA,dc(@COS,z$吃<_$w(p_,dc(p,`k(̓pw$H(p+'@'@@AA,fo(@C$吃$F,\&a@@p(@pCOS,z$吃pO T,z,G$吃O4T,z,G$吃OT,z$吃< O_/@@+@S(po p $p'plSplS@O@PplSO,o(@C{z{ ,\](dplp{ zplp(lpOE+Ep;OE8p8@+Pp(8@PAA8p,C@AA,dc{ҠY,,N,\LJl@{L H G IpILpO,\*@_,4@Yp(YpG/pp{5<_YG.Y@O@?/PY@O@/PpY@O@PpO@{L II_Lhplp(4pOT,z@$Z@<@I<@G <@$(<@`$(OTOTI@@@Ж,h@Yp$AOTOTI@@@Ж,h@Yp$AI@@@,\@_,4@pOU,$ֈ@p@@<_@GI@@@OU,و{I@@@OU_,4OUI@@@I@@@Ж,h@Yp{O*UZ,z@$(YpC Y@$<YwOIUh,z@$h@?o|PHh_l,̀@AAp(A(@(p@,$ֈ(@O @hpph_,4phpOOlpOOOiUlЖ,@AAYp(AC Y@$Ydp,\ԯ@AAYp(ACY@{rZ@<@/<@G <@ {Y<@8{Rhd,Z@AApA@{=hd,@AApA@{#hd, @AApA@{@{L IppIL(Zpw OKZpZ@+Ppw @$앃,NZ@?o|PwBZAAAdpd@+Ppd@? P{ {dp{d,@p$(tp`xUp|UpUpUpUpUpUpUpUpZOxU,.@p{Z,.@p(pwOUZ,\@,z(pOOZ_,4{ p@{L IpppI@{L IpppIL(Zpw OKZpZ@+Ppw @$J,NZ@?o|PwBZAAAdpd@+Ppd@? P{ {dp{d,@p$(tp`UpUpUpUpUpUpUpUpUpZOU,.@p{Z,.@p(pwOUZ,\@,z(pOOZ_,4{ p@{L IpppI@{L IpppH(LI@@@,lI@@@d ,4IHHHdpd@@PČpd@@PŌpd@@Pƌpd@@PnjpȌpd@@PpOd@@@ ,h΂@AAYp(ACOU@$OȌOUY,d@@? P dAAQ@{0@@ʌpd@ @Pˌp ̌p͌p Yp<YGY@OŒ@dAYAQPpYp{ՌpOČ@{L H IppIL(Zpw OKZpZ@+Ppw @$(xptp ,NZ@?o|PwBZAAAdpd@+Ppd@? P{ {dp{ d,@p$™(tp`UpUpUpUpUpVpVpVp Vp ZOU,.@p{ Z,.@p(pwOUZ,\@,z(pOOxZ_,4{ xp(xpw ,N@{L IpIL@p(@ <@{OVYp{OVYp{ OVYp{Y@{L IppIO$V,zO&V$},|Ȅ@,zO:V@,|Ȅ@,zOVV<,|Ȅ@,zOrV},|Ȅ@,zOV,zp@<@C$t@<@Wz@@$tWOVOfS,z{ZOVO@,z{DOVOV,z{.OVOV,z{OVOV,z{OV,z<wOV,z{cOV(p OV@{ OV@@,z(p1OV(p OV@{ OV@@OW,zOW($pw OW@{ O%W@@,zO,W,|Ȅ@,zOAWAA@A@@@@AOAQ,zOYW4,|Ȅ@,zO$V,zL IILOWL@@AA@O@P,zOW@@AA@O@@P,zOW,zYp<YK$❃<YO$❃<Yw$ܝ<Yw$ܝ<Yw$ܝ<Yw$ܝ< Yw$ܝ< Yw$ܝ<Yw{yY@@AA@OO@Pdp<ldC8OWY@@AA@O@Pd@@AA@O@@P,z{%OWY@@AA@O@Pd,zYpz#O$V,zL IpppILOW,z(,pw (0pw{7OXO\<w O X@{ OK@@,z$O,XO?XO\(Hp <@8w{<w O X@{ OK@{ ODX@@,z<@8,\"[@AAhp(AK{OV,z{H<_"wONX,z{-<_wOVX,z{O\Xh,z(,pw (0pw{O`X,z{OiX,z(HpOM?,z{OrX,z(,pw"(0pwOyX,\@,z{O$V,z(p,(Hp#(,pw@@,8@dp{@@,8@dpOX(p OX@{ OK@@d,z(Hpw$(,p$d@Pp@!GAA+A@@,`ֈ@plp(lpG(OVO+e,z{(OVO.e,z{OYd,zhpd@@<@hO,\(@w $ȃ{hpO3eA@(Apw O(^@@,zhpd@@<@hO,\(@w $ȃ{hpOQe@(pw O(^@@,zhpd@@<@hO,\(@w $ȃ{hpOoe@(pw O(^@@,zhpd@@<@hO,\(@w $ȃ{hpOe@(pw O(^@@,zhpd@@<@hO,\(@w $ȃ{hpOe@(pw O(^@@,zhpd@@<@hO,\(@w $ȃ{hpOe(pw Ė@{ O(^@@,zhpd@@<@hO,\(@w $ȃ{hp(؜p>Oe؜,zhpd@@<@hO,\(@w $ȃ{hpOf ( p O7f@{ O@f@@( p OKf@{ OTf@@,zhpd@@<@hO,\(@w $ȃ{hpO`f M,zhpd@@<@hO,\(@w $ȃ{hpO~f$M,zhpd@@<@hO,\(@w $ȃ{hpOfo@(opw O(^@@,zhpd@@<@hO,\(@w $ȃ{hpOfo@(opw O(^@@,zhpd@@<@hO,\(@w{t{hpOf,zhphpd@@<@hO,\(@w{?{hpOf,zOf,zOg,zO g,zL H IILO#gAA@A@@@@AOAQ,z(p$΃O1g,z(p$OYg,z{"Owg,zOg<,|Ȅ@,z(<pOgDH,zOg,z<wOg,z{Og,zO h@@@@,zO"h ,zOn,zYpO\n,zOzn,zOn,zYp(Zp$9ԃ(bpG$9ԃOn@@,8@,zYp(pOn,zYpOnbb,zYpO&o,zYp(pOAo,z{OKo,zYpOOo(p OMd@{ OQd@@,zYpYpd@@<@YO,\(@w @$C؃{Yp(pOOmo,z{Oo,zYpd@@<@YO,\(@w @$C؃{YpOo(p OK@{ Oo@@Oo,zYpd@@<@YO,\(@w @$C؃{YpOo(p OK@{ Oo@@Oo,zYpd@@<@YO,\(@w @$C؃{Yp(Zp$փOp,zYpd@@<@YO,\(@w @$C؃{YpO;p,z(4p"OVp3@@b,z{OKo,zYpd@@<@YO,\(@w @$C؃{Yp<wOfp,z{Op,zYpd@@<@YO,\(@w @$C؃{YpOp,L9@,zYpd@@<@YO,\(@w @$C؃{Yp(Hpw${׃(,p${׃(Zpw}(pG,\"[@p(pO\<_"wOp,z{Op,zYpd@@<@YO,\(@w @$C؃{Yp(Hpk(,pwb((pwY@AA@<@KV@<@WO@@$rpzpz+Zp#(<pwqpOr,z{zyzvqp{/+Opw(qp qpzOqp{ qp+Op(pg@@,dc(p d,t|p;HgHHppp`p,\pl@\p+ppw"(pYpdp$8⃀{$CჀ@pPppdp\@@<@[xp@Pp\p(qp8<_qG-q@q@pPpqpq@q@Pp(pq@O،@pPpqp(p/( ppw ? pw{q@Oؐ@pPpqp(p Yp$8⃀p@@AA@H@(Ppw*p@!GAA+Ap@@,<ֈ@ppdpdpd@@AA@t@PAAlp(Aw$Ⴠd@@AA@x@(Pp[p<qC:lq@@@,l$(@qpYp{ p{(YpO$Ⴠ$߃d@@AA@I@@AAQhpl@h@?Ppwhp{Jhp(hpO?hpl@h@?Ppw*l@h@p@AlAAh,x׈(@whp{{l@h@+Ppw0qd@@AA@t@P_,4qpYp{d@@AA@I@@AAhQpz<YwdHHHp$8⃀{d@@<_@GOOtZ,{OOt,{$CpxFFFdp(dpK>d@@AA@t@(Ppwxp{ d@@AA@t@PA+Qpwxp{{dp{<$w|@(|pw OK@@Pp$C<$$󃀄t@PAAPp(AP@+Ppw5{(pOPp(퐀pOO6t,$CP,&@PpP@?o\PwPpP@PAAhp?%A$򃀐PpP@PhpOKPp+hpw3(pOPp(퐀pOOWt,$C?/h_g?9hW_(pCh@@AA@O@PPp{:AA@A@@@@AOAh@@HH@A@@A_@AQPp{q?*hw6(pK-@@AA@OT@PPp(Ppw OKPp{5h@!GAA+A _hph@@AA@O@PPp(Ppw OKPp$C$?&h$󃀠PI@ol@@I@op@@,(@C3(pOPp(퐀pOO}t,$Clp, (@OYolpl@@AA@Os@0,@hp(hpChpOOuh,OPp{ O(sPp<xG$!pI@_@@4,4IF_FF|p|@?o\Pw|p(pOPp(퐀pOOuZ,|@?&P$C|@@+Pp(|@@?o[Pw|@@?o]Pw{$C|@@??P_)|@@?oZPW|@@|AAQF FFPp|@@PAAh,x@AAp(AC$C(p@@AA@O@PxpOOuh,(`spgp@@AA@`s@(Pp<@@AA@`s@P,@@AA@`s@Ppp{`s,I@_@@O,4h@@@AA,\@`sp(`spw$pT@@@p@@AA@H@P,l$(@w p{(pC p{p{ap<C=T@@@p@@AA@H@P,l$(@w p{<w p{p{64p@@AA@H@P,@p(p(p,OOu,OPp$C(xpG$C<xGP0_,4$0,$ֈ@lp4,$ֈ@p<xO8,$ֈ{@@pl@@p@FFFdp(dpO(lp (pw({P0_,4P@_@Pp$0Tpdp0@d@p@FFFTpYp(p(퐀pOO2vZ,{ pOPp$C(hpOTYp<YCD0Tpdp@@AA@I@@A_AQ,`ֈAAHHAIAAH_H@Xp@@AA@I@@A_Ap{P"p{H'p{@'p{8<xw Lp{*OT , @O@Pp$C @T@p@AA?Qw6OT@@@ @@@, @O@Pp$COT , @O@Pp$C0,8(@w,(p(퐀pOO^uZ,$CO<>$w Ov@{ Ov@@0,􉈀@,<>$wPw{$Ch@t@Ppp@@AA@d@@h@@@,J!(`p:p@@AA@`@@|AA@A@@@@A|A,J!|,4(@C$CppzOOux,OPp(p$C<_$w>pxpO(sPp(xpG$C0<_$w@{@@ ,z3@Pp(Ppw'(퐀pOOuZ,$C(pOP_,4OPp$C<_$$hAO(sPp(xpG$C0TpT,$ֈ<@,(p(퐀pOOuZ,$COPppp<pO$bAxp<xO$8Ax@@AA@I@@A_AT@PQpTpx@@AA@I@@A_AQ@O!G@PAA+A>x@@AA@I@@A_AQ,`ֈxAAHHAIAAH_H@Xpx@@AA@I@@A_A<@Pp<pT,\xAAHHAIAAH_H@Xp<Tp{,(p(퐀pOOuZ,$CxpznT,\@pPO1x,$C<_$$kC(pOPp<xG'(퐀pOOCuZ,$C4,8(@8,8(@w){(퐀pOO^uZ,$C04,\@8,\@,z3@Pp(Ppw#(퐀pOOuZ,{K(pOP_,4OPp{'(p(퐀pOOBxZ,pphpQ!OObxZ,OPp{!OOyxZ,OPp(퐀p lsp(퐀pOxP,z{ OK@{P@{L H G F IpHLI,l(Yp Y@+Ppw{OK@$Epdp<dGd@O@YAdAQPpdp{Y@@? P YAAQ@{0@@pY@ @Ppdp< dG2Y@@@d@@AA@O<@P,x׈(@w{dp{< dw?p?p{.dp< dG0@{1@@pd@ @@H0HHppO@{L H IppIL,\@YpOlO\XY,Ol@{L IppF4L(Zpw OKZpZ,$ֈ@Yp(퐀p@C$X>@<O Zp@pzC@@Pp@@AA@I@@A_LA@GGGQppZp@pz (dpw>(DpD,Dp( =p =, =p@$rI@oL@@I@_L@@ =,)@,p(,pp0A,HX@@Qp,p0p+@Kp(pC>(DpD,Dp( =p =, =p@$r{0pp(DpD,Dp( =p =, =p$rhpZGGG8p8@?(P.0@ZAQPpZp0pp(pC @$r$rhp8pIGoLGG@dp(dpC$<O(@@,C@AA,@dp(dpC{xOdˑ`ˑ,(@C{`zs<_twOLZptpz]<lwo\,C@AA,@dp(`ˑpOOdˑ`ˑ,(@C{@{(ppON,z@{L H IpILYp(pw$䬄@@,m,q(@Oy(pjdp<dGbd@@AA@O@P,<@O=Og,zd@@AA@O@Pp,q{dp{$Yp(ȖpYp{'(pOYp{(pC(7pOYp(Yp$Oi$7,zOu,zO,z(Dp$(7p$(pjdp<dGbd@@AA@O@P,<@O=Og,zd@@AA@O@Pp,q{dp{Oͩ,zL IILZ@p(@ <@{8(tp O穑@{ O쩑@@Yp{%(tp O񩑀@{ O@@Yp{ ODYpY@{L IppHL(Zpw ODZpZ@+Ppw@{MZpZAQ@@YpZp+@4?Xw@{{@{L H IpppILt,@AAlp(A (xpO{ @$﯄pdpx@@<@dK$dAA@A@@@@AZAQt,й(@gdAA@A@@@@AZAQtl,x׈@A@(Aw@@hp(@6dAA@A@@@@AZApA@ @Ptl,x׈(@w{d@{N(hp@{DdpzTxAA@A@@@@AZApA@@Ptl,x׈(@w x@@{ {@{L IppILt,@AAdp(A (xpO{@{cpYppAA@A@@@@AOtAd@@HH@A@PppAA@A@@@@AOT哀Ad@@HH@A@Ppdpz3(ppGppxpp$ńpAA@A@@@@AA<Q$5Ä<xG$'Äx@@AA@O𷓀@P,t󈀄x@@AA@O@(Pp9x@@AA@O@P,x@@AA@O@Ppxpppp@@AA@Ԗ@PDp{ xp$ńpAA@A@@@@AA<Q$ń<G$ń@@AA@Op@ODPpT@Pp(pG$ĄAA@A@@@@AO\A(Qpw$ĄAA@A@@@@AO\AQO ,x׈(@w$ĄAA@A@@@@AO\AQOժ,x׈(@hAA@A@@@@AO\AQOڪ,x׈(@6AA@A@@@@AO\AQOߪ,x׈(@wZ{@@AA@O@(Pp>@@AA@@@AOAA@@AA@O@P,J!@@@@AA@Ot@Pp@@AA@O4@Psp{XpTsp{ p(ppG,\X@@,m(pw$Ƅ(ppG$ƄpAA@A@@@@AA<QwHO䪑ppAA@A@@@@AA@@AA@O@P,z{rpAA@A@@@@AA<QwQpAA@A@@@@AAHH@H@@@@AOAQhpO󪑀ph,zp@p(@C@{L H G IppIp,\(@{p,\b<@O{8,B^@{L IppILZ@<@C$`Ȅ@<@_$`Ȅ@@$t(pGO,z@$tȄpp,N$tȄ(pGO,z@$tȄpp,N$tȄ(pG(ppO5,z@{`xpp ,N{F<Zw @{ @@YpY,(@G@{"Y,N{ORZ,z@{L IpI(Zp O+@{ O@{L IIZ@<@<@G(@ {$<@{O@{O+@{O@{ O@{L IpILpZAQ@@YpZp+@V?Y_#?oY?Y?oY_"?oY_{OY@@,z{OY@@,z{L IpIO$,zOɫ\,zOث7,zO諑 @+Pp  @{ O@@,zx777,$ֈ@,x׈(@Ox77,z{Ox7,z<@G <@$؄<@$؄@$T􄀠O,z@$T􄀠p,$ֈ@YppZp<кZCvZAA@A@@@@A|AQpY,x׈(@wCZAA@A@@@@A|AQZAA@A@@@@A|A,(@C{Zp{@$T􄀄ZAA@A@@@@A|AQZAA@A@@@@A|A,`@$T{sO,zpYp<кYCHYAA@A@@@@A|AQYAA@A@@@@A|A,(@C{Yp{@$T<Z"<Z,\ԯ@AAYp(AC Y@$T􄀄Z@<@C$4􄀼@@+Pp O@PAAp,z{ڠOg,z$>YAA@A@@@@AOAA<jYAA@A@@@@AOAA<4LYAA@A@@@@AOAAݠ@,zO,\ т@,ݠ@,zOp,ݠ@,zOظd,zOh,zO|,ܠ@,zOD,ܠ@,zO,_,zOI_,zOhк,zO}o@,zO ,zO,.ܠ@,z$G(pOOO,z{Oι,z$G(dpwO޹,z{idp(pX@p(pw OpO򹑀@P@,@,z@ p{$G,\:}$G􄀠Og,z,HOg,z$G􄀠Og,z,NOg,z$G(pwO ,z$>O,zp<GF@@AA@O@(Ppw{,O*@@AA@O@P,zp{O2,z($ pOU$ ,z{Oj,z$G,\L$G(0p((4pOӱ,zpp@$T􄀠O[(p O@{ O@@,zOq(p O@{ O@@,zO(p Ox@{ O@@,zOg,z$G,\I$G,\:$G􄀠O,m٠@,zO,Q٠@,zOĺ,5٠@,z(Hpw <{<w(pw{Oغ,z{Z(p<w(pw{O,z{-<<w(pw{O7,zO(pO OD@{ O@@(p O@{ OD@@Ė,zOg,z$G(0p((4pOӱ,zpp@$T􄀠Og,z(pwO,zOϻ@(pw Oố@@,zO軑@(pw Oố@@,zO,zO ,z(0pOg,z$G􄀠OL,zO&L@(Lpw Oố@@,zO6L,zOGL,zOUL,zOi@(pw Oố@@,zOy@(pw Oố@@,zO@(pw Oố@@,zOl<,zOh<@(hs@@+@w ZZp{pw@@+@w ttp{@e{rZ@@Phph@O!G@PAA+Aohpt@hPpx@Pp@$a Z@?&P$\ ZI@@@I@ @@,@hp(hpC-,$ֈ@AhApAGGGp(dpO(hpO $pO!񑀠,z(tp9(dpO0(hpO'd@@<@$O,\(@w{.{$p,(@|@< @w{ (pz,p4pۑppۑp@{L H G IpppIL(pYYp<YC8Y@@AA@@(PpY@@AA@@P,Yp{à,ppL IpILYpOO,~(pOBO<<w O@{ O@{ O@@,~Yp{OO,~Yp<lO.O(lp O@{ O@@,~Yp<hO.O(hp O@{ O@@,~Yp<dO.O(dp O@{ O@@,~Yp<O.O(p O@{ O@@,~Yp<O.O(p O @{ O@@,~Yp<O.O(p O@{ O(@@,~Yp<O.O(p O3@{ O>@@,~Yp<O.O(p OK@{ OU@@,~Yp(tpwYpOOa,~{e(tpO\Yp(|pwOj| p{.<|wOu| p{<|wO| pO| ,~<xO.O(xp O@{ O@@,~Yp<pOR(ppwOO,~{0lO,Ol,~Yp(YpwOO,~OO䑀,~L IpppIO$O䑀O| Ж,@AAt p(ACt @$0pl| ,&@_,4{OC,z@$z1,\ԯ@AAt p(ACt @$ G @@AAHO p-? pL@@P@ pL@@PA pI@_B @@L@@@,IG_8 GGLpI@_8 @@,$ֈ@ppI,6@p(p`(TpCY(p,I@_@@O(O:LI,{&I@_@@O@O:LI,{S(p*I@_@@ONTLI,{$I@_@@O`TLI,(pw$(O䑀 p p@<@$<@G(@ {'<@{ GGGp{p{ p{;@<@$<@G(@ {&<@{GGGp{ p{p ,.p<K$ O!񑀄@@AA@@P,z(ppw$@@<@K(|pw$(hpOy@@AA@@P,$ֈ@ p@ AhAp(A@@ p@@AA@@P,$ֈ@AhApA@ @@tp{tpd@@<@tO,\(@wp$K{tppz(|pw$JOX<Xw O@{ O@@\<\w O䑀@{ O@@`<`w O䑀@{ O@@,z`,4@AO.A,@ pA p O@@,l(@O.O O@@,@A,z{8 Oz?O{G,H(@KO ,zO,zp<lOlplp<ۑOۑppۑp,\(pO pp@{L H G IpIL(< pw <Z{ ,\$ٛ<_Zw O@{ O@@dpdO䑀O| Ж,@AAt p(ACt @$ٛl| _,4l| p,\ԯ@AAx p(AC x @{ypxpO,D@AAYp(Aw KYpxOY| ,p,ɀ@t p@(t pO@@pp{L IppIp@@AA@8@(PpwO,z@$p@@AA@@@(PpwW<G <xG{,b]{58,B^O푀,z(ppЖ,^\{6OO䑀O| ,@AAx p(AC x @{@{L IpppILpO葀O䑀O| Ж,@AAlp(AC l@$| O⑀,й(@wFpO葀O䑀O| Ж,@AAlp(AC l@$l| p| @?o\Pw)| ,VD(@GO鑀,z@$l\_,4(pOaOO䑀O| ,@AAlp(AC l@$\O⑀,й(@O ,z@$pYpYO,,p,$ֈ@hphYpYdpYlh_@@,4l,$ֈ@hphYpYO{,وYpO4O䑀O| ,@AAlp(AC l@$| ,$ֈ@AAlp(AG @$| @?o{PAl@| @p@AA?o}Q(lOD| ,l| pO| IY@p@@_AA,(@COK,z@$|O_к,֮@hp(hpCTO_O,\|O_к,֮@AAhp(ACOf,zpp@{ChdpAA@A@@@@AA@@@, @AAppA@{L IHLppYp<YO$O葀O䑀O| ,@AAx p(AC1<x wO鑀,z@${x @$| O⑀,й(@{pYp$+| Ot O葀, @AAx p(ACx @$pxpxO,p,$ֈ@xpxp| @?o\Pw | ppxA| HX@@Qp| pxp+@{؜xpx@ PpxpOO䑀 I@@@Ж,f@AAx p(AC#<x w @${x @$\| p| ,$ֈ(@G$lOd,l| pxA| HX@@Qp| pxp+@{؜xpx@ PpxpOO䑀 I@@@Ж,f@AAx p(AC#<x w @${x @$\| p| ,$ֈ(@G$lOh,l| pxA| HX@@Qp| pxp+@{؜xpx@ PpxppPpxpx@ Ppxp(pOiOO䑀O| ,@AAx p(ACx @$\O⑀,й(@O ,z@$OO䑀O| ,@AAx p(ACx @$| ,$ֈ@AAx p(AG @$| @?o{PEx @| @p@AA?o}Q(lOD| ,l| pO| Oxx@p@@_AA,(@COK,z@$|Oк,֮@t p(t pCXOOH,\|Oк,֮@AAt p(ACO,zpp@{[t pAA@A@@@@AA@@@, @AAppA@{O,z@{L H IpGLdphplp(Zpw O䑀ZpZ@+Ppw @$^Z@PA!G@@+@Z@PApAGoGGdpZp{ @$^Z@PA!G@@+@.dAZHX@AHAHHHHG@GG@@GoGGdpZpZ@?:PwZp{Z@+Ppw $6{ @$^Z@PA!G@@+@Z@PApAGoGGhpZp{ @$^Z@PA!G@@+@.hAZHX@AHAHHHHG@GG@@GoGGhpZp<@<>@G <@{(@G<>@G <@$8Zwk(葀pJ,\s@xp(xpCpp@$۱x@葀@<葀@wpp@$۱{(t pwpp@$۱$nl,@|p<twq<|wpp@$۱l,@| p(| pwO䑀| p| I@_@@,й(@pp@$۱{:<tw<|wpp@$۱{<tw<|pp@{o(t pG{(,t p(t pOzX<>Zw@(葀pw@@pp{@(t pw@@ppp@{L H G F IIL(pC%Oz,zpp@$ pxp_Yp(Zpw O䑀ZpZOxI,0f<@O pZpp(pG$AA@A@@@@AO\A(Qpw$pAA@A@@@@AA<Q$AA@A@@@@AO\AQO,x׈(@w$AA@A@@@@AO\AQO,x׈(@hAA@A@@@@AO\AQO,x׈(@6AA@A@@@@AO\AQO,x׈(@w{oU, ,\⿄,\⿄z(pgZ@+Pp2OAA@A@@@@AOAQZ,z{.OAA@A@@@@AOAQ,z,\⿄Z,$ֈ@Yp(YpG$۴Y@@@,\@dp@@AA@O@(Pp9@@AA@O@P,@@AA@O@Pp(dp)dZ,@@AA@O@dPp{@@AA@O@PpYp{C@@AA@O@(Pp)@@AA@@@AOAA,J!@{L IpILhpOT⑀⑀OO䑀Ж,@AAYp(AC)I@_L@@OO䑀O䑀ЖI@_p@@,@I@_p@@O䑀O䑀O䑀,@I@_(@@,@t p(t pC$Ӆ< Đ$ȅ,\6\@lp@<:l <=l{@@p(@0,\J\@AA+AwO,zt p$Ӆ(pw0,\J\@AA+AO,zt p$ӅĐp@<@C$rȅ@<@_$rȅ@@$\ (< p O,zt p$Ӆ{'(xpOC,zt p$Ӆ( p Oy,pp@@AA@I@@A(Ap$ȅ,p@@AA@I@@A(Ap$ȅ@@AA@I@@A(Ap$ȅ,pppp@@AA@I@@A(Ap$ȅ(pw$ȅOO䑀O| Ж,@AAt p(AC'<t wO,zt p$Ӆ@@AA@I@@A(A(Qp @@AA@I@@A(AQ,| ,$ֈ@x p<_x OO,zt p$Ӆx @@@,\AAHHAIAAH(H@Xp@@AA@I@@A(A(Qp?@@AA@I@@A(AQ| ,@@AA@I@@A(Ap$ȅ(pw$ȅ<w O@{ O@@O䑀O| <w Ж@{@@,@AAt p(AC?<t w0O!<w O@{ O@@,zt p$Ӆ@@AA@I@@A(A(Qp7@@AA@I@@A(AQ,@@AA@I@@A(AQp| ,&@| p| ,$ֈ@x p(x pG$Åx @@@,\AAHHAIAAH(H@Xp@@AA@I@@A(A(Qp?@@AA@I@@A(AQ| ,@@AA@I@@A(Ap$ȅ(pw$ȅ($pO/,zt p$ӅOVO䑀O| ,@AAt p(AC$Ӆ| ,&@| p| ,$ֈ@AAx p(AG$Ņ@@AA@I@@A(A(Qp @@AA@I@@A(AQ,x @@@,\AAHHAIAAH(H@Xp@@AA@I@@A(A(Qp?@@AA@I@@A(AQ| ,@@AA@I@@A(Ap$ȅ(pw$ȅOmO䑀O| ,@AAt p(AC<t wO䑀| p{$Ӆ| ,&@| p| ,$ֈ@x pt p<x t CA| @t @?o\P{ t @| @p@AA?ovQw{ t p{<x t wO,zt p$Ӆ@@AA@I@@A(Ap@@AA@I@@A(A(Qp7@@AA@I@@A(AQ,@@AA@I@@A(AQp| ,$ֈ@AAx p(AOVx @@@,\AAHHAIAAH(H@Xp(@&@@AA@I@@A(AQ| ,$ȅ(pw!@@AA@I@@A(Ap$ȅOCDO䑀OЖ,@AAt p(AC$Ӆ@@AA@I@@A(At p$ȅ(pw$ȅOGGO䑀OЖ,@AAt p(AC$Ӆ@@AA@I@@A(At p$ȅ(pw$ȅO'T(OO䑀Ж,@AAt p(AC<t w t p{$Ӆ@@AA@I@@A(At p(hp'(t pO,zt p$Ӆ{$O$Đ,zt p$Ӆz5pP plT pdpp@Ppl@Pp Đ@<@/<@G <@ {x<@l{qpĐ_,4{y( p2lĐ_,4l,$ֈ(@Odp{pĐ_,4p{$OC Đ,zt p$ӅP ,&@P p(p$ʅ(pOiObO䑀O| ,@t p(t pC<t $Ӆ<t l| _,4dp$ʅ( pwO}O䑀O| ,h@t p(t pC<t $Ӆ<t :l| _,4,\ԯ@AAt p(AC$Ӆdp(dpw+(pl_,4{ l@PpT ,&@T pP @+Ppw9< Z_p@@AAH,4IG_GGZpZ@?:P :pZpZ@@?.PZ@@? PZ@@+Ppw#{O Z,zpp@$ᅀ(ppw"O ,zpp@$ᅀZ,$ֈ@lp(ppG$ᅀpAA@A@@@@AA<Q$߅pIGodGGpI@ @@I@_@@I@_@@,0fI@ @@I@od@@?,4p(p<@w$2ꅀ<@G(@w$酀$<@w$w腀<@w$X腀$<@w$N녀<@O$E텀$腀<@w$<@GJ<@w$酀<@G<@w$酀<@w$$<@w$2ꅀ<@w$$<@w$H腀<@G<@w$<@w$7腀$<@w$q<@w$$<)@w$S煀<)@O$h慀<#@w$M<#@GJ< @w$< @G<@w$<@w$$p(p (pOzp$@PpO=,^@,\@hph@{L H G IpH,LZ,-@hp(hpC h@$3<-Zw[,\˂@p(pw O䑀pp@+Pp$@? P@? P{p{{{ք@?o{PwoJZpZ@h_@pp@{1O$,ӄ@AAppA@{OY,z@{L H IIOZ,zOJZ,zpp@{L IILYpO$HHOAOAЖ,@AAAp(ACA@$6(0pB,\ԯ@AAAp(ACA@$6OZ,zpp@$6A@<@C$6@<4@_$6@@$[OZOFX OoЖ,f@AAAp(ACA@$6<o(<oOHX,zpp@$6,\ԯ@AAAp(ACA@$6<ow o8p{<ow_8pppp@$6O,"$6O$,$6,\ $6O0OZOZЖ,@AAop(ACo@$6,\ԯ@AAAp(ACA@$6oppp@$6OhNNOAO]NЖ,@AAop(ACo@$6,\ԯ@AAAp(ACA@$6o`p@$6OHOAOHЖ,@AAop(ACo@$6,\ԯ@AAAp(ACA@$6ooppp@$6OIOZOAЖ,@AAAp(ACA@$6,\ԯ@AAop(ACo@$6<Ĝ<Ĝw<Ȝw{pp@$6AȜppp@$6OX ,΄@op(opO ppo@$6opO,΄@ApA@$6O[O3[ OoЖ,f@AAAp(ACA@$6,\ԯ@AAAp(ACA@$6oTppp@$6O6[O9[ OoЖ,f@AAAp(ACA@$6,\ԯ@AAAp(ACA@$6oPppp@$6O\,ẗ́@AAop(AC o@{gpp@{ZOW[OAOoЖ,@AAAp(AC A@{"oO,@{@{L IppI LO4IpIO`\OjCЖ,@AAdp(AC d@$7(0p6,\ԯ@AAdp(AC d@$7OZ,zpp@{pd@p(@ <@${\,\ԯ@AAhp(ACh@{JXp{AO{OooA,DŽ@AAAp(ACA@$M< oGO^,z@$M(p$=<_@#oO _@#opop\,B@Ap<A0,\zs(@w%(ppO^A,z{oAp< <{=<_o2<_o'O^^,zO^,z@$MA@@p@p@ppAA@A@@@@AOA pAA@A@@@@AOAp(ppl(pwc,\zs(@wXGp<ow$G<o$$G(hph,hp\OaC,"(@^\O `,"(@B\O$`,"(@&\O'`,"(@$ G{,\ԯ@AAop(ACo@$MpAp<_AGPA@@AA@O8@AAAFFAO8AQH<5Yw HAA{HAAAPpAp{<5Yw 0ph!?o|hOf,z@$]Sdp?>hwd@?>Pw dpd ppd@? Pd@? P{dp{d@+Ppw2O.f?>hw O;f@{ ODf@@,z@$]S?>hw%d,ޏ(@COLfd,z@{Y\ p@?o|hw@@` p(` p(< pOaf,z@{Oh d,J!@{L IppHL\ p` pd p(h ph ,h pZ@Pp(pw OAp@+Pp$oT(Hp$fT<eU<eL<eC<e:<e1<e(<e<e<e <e{8OeT,z(|pOf,z@$W{ @$Whplp,$ֈ@dpdHHHYp(YpK<@Y@Pp?o}w{%{?>wYhp{?o|wYlpYp{(hpK$U(lpK$U(Hp$U<eU<eL<eC<e:<e1<e(<e<e<e <e{6OeT,z(|pOf,z@$W,&@pZ@Pp@$W\ pYpwY@@p@AA?>Qw d p@Y@d AA@HAHHp@? P@? P{p{@+Ppw3O.f?>w O;f@{ ODf@@,z@$W?>w',ޏ(@COLf,z@{sOh ,J!@Y@p@HHHp<_!@? P@? P{ p{܄@@Pp,&@pZ@Pp@{L H IpppILYpdphplppp(Hp(,p&,\&a(@K{Of,z@$7\OfOAOoЖ,@AAop(AC<oo@$7\o,$ֈ@Ap(ApG$rYA@@@,\@AAYp(AwOf,zp$[{Yo,OfOAOoЖ,@AAp(AC<$[o,$ֈ@Ap(ApG$rYA@@@,\@AAdp(AwOf,zp$[{do,OfOAOoЖ,@AAp(AC<$[o,$ֈ@Ap(ApOLA@@@,\@AAhp(AwOf,zp$[{ho,Oo,@AAp(AC$[(Yp$[xpxpO_,\lpOg,[@@,m,B^Ж,^\pop(opC/,\]OAOAOo,@op{̠o,$ֈ@Ap(ApGO g,z$[A@@@,\@AAYp(AwOf,z$[{Yo,Og,[@@,m,B^Ж,^\op(opC8<o/,\]OAOAOo,@op{ào,$ֈ@AAA,\@AAdp(AwOf,z{T{do,O"g,z,\ԯ@AAp(AC{oIYdh,؋@@ pp(lpO,[<O xp(hph,hp(dpd,dp(YpY,Yp<O(Hp<O ,\]@{L IppH_PL\ p` pd p(ZpC Z@$/fZep<ZwlO LLOAOAЖ,@AAdp(AC)O3nAp(Dp,\zs(@w{OSno,z$xOpnAp(Mpw$xOA,\@,J!AAp(Dp,\zs(@w~{p,$ֈ@HHHp_@@hp(hpC$h@<@K8@<@W1@@$o8p{8p{+Zpw{$zj(ppЖ,^\,\]hp(hpCaOnOAOo,@hp@hp(hpC$h@<@K8@<@W1@@$o8p{8p{+Zpw{$zjZO/o,й(@ZO9o,й(@w{I@ @@O=o,{JZ@+Pp+Z,$ֈ<;@WI@ @@O`oZ,{I@ @@Ovo,I@ @@,[@@,mZO/o,й(@"ZO9o,й(@,B^{ ,B^(ppЖ,^\,\]hp(hpCaOAOAOo,@hpOp,z$!Oq,z$!O%q,z$!OAqc@@+@ Obq@{ Oeq@@,zOiqc@@+@ Obq@{ Oeq@@,zOqc@@+@ Obq@{ Oeq@@,zOqc@@+@ Obq@{ Oeq@@,zOqc@@+@ Obq@{ Oeq@@,zOqc@ @+@ Obq@{ Oeq@@,zL IIL IpppIL IpppI(Zpw OrZp(pw ,\(>Z,p@@@,#L IILZ,$ֈ@Yp_H@<@ < @{^@@,n{^@@,m(pp-Ж,^\(4pwOrT,z{@@,m{@{L IIL(@pw @$(Hp (Dpw{ @$,\_{*O,>_{O O,>_{,\L IpIssp(pi( ppw? sY+spS?sL?sw{Cs@@,:(@C/Or,pOHz,pp,NL IpppILdp(p (Zpw {$ppL IpppI_LOP pOT pDphp\@PpO.,<\Ogdp\@@PA?-QO\@@PO,й(@w @$Ć(hp d\pd@@AA\phpp\p(\pG$(†\p\@PA?=Qw @$Ć\@PO,й(@w@$Ć$%†\@PA?-QwI\@PAAQYpY@@, @dp(dpC!< Hw @$Ć{,l{5I@@@O(,\@PI@@@,z(0pw$†(Hpw}(Hpw(Dpk(Hpw5,Z(@'< HwO,M{O,]{n(tp9 AA@A@@@@AO@A @ @+@w?+4 @$ˆ(pZAQ@@@{@@8p AA@A@@@@AO@A @@+@(pw @$ˆ{8 AA@A@@@@AO@A @@+@w(p @$ˆ@<@C$zˆ@<@_$zˆ@@$$OL8I@_ @@,h΂@p(pC @$ˆLp$ˆ8_I,̀(@I8pOL8,J!$ˆOL8I@_ @@,h΂@p(pC @$ˆLp$ˆOL8I@_ @@,h΂@p(pC @$ˆLp$ˆp8@+PpR8@?/P_8@?7PW{ @$ˆ@@AA@o@8AQHp@GHGGp8p{Lp$ˆ8_I,̀(@I8pO8,J!$ˆ8_I,̀(@I8pO8,J!$ˆ8_I,̀(@I8pO8,J!$ˆ8O,O8,J!$ˆOL8I@_ @@,h΂@p(pC @$ˆp$ˆOL8I@_ @@,h΂@p(pC @$ˆl,9{O>,I$݆\@P,\@lp< lO/<lG&l@@p@pz,\ԯ@AAڒp(AC ڒ@{ڒ,&@ڒpڒ@+PpwOs,zp$;(,pO+(pG (pG{O,zp$;(pO}p(4pO,zp$;,$ֈ@p,J̀(@wO,zp$;O,J!(pG$Gp(4pO’,zp$;(pw O(p@+PpwOA’,zp$;,&@p(lp`lp_pI@_@@I@@@,0fl,й(@wOa’,zp$;O,J!(pO-<$(\#pwO’,zp$;(|pO](lpO’,zp$;{O’,zp$;(pOÒ,zp$;(pO-(p$<ONÒ,zp$;(pwD(DpG(\pG (pG{/(p (ppw{OÒ,zp$;(lp/< <{OÒ,zp$;(p$(pw$tp@@AA@OB@pPppp,$ֈ@ApApAGGGxpOÒO(OڒI@@@Ж,Tk@AAp(AC-<$;,\ԯ@AAp(AC$;$n@@AA@OB@xPppxpxAڒHX@@Qpڒpxp+@<p@_@<@x_%O'Ē,zp@Ppp$;{<w zp_l,̀lpOz,$ֈ@H,$ֈHA@AA@@<o@C*Oz,وOzO=Ē,و{z$p(DpO (@p O?Ē@{ OYĒ@@p{/(\pOOsĒp{(lpOĒp{ OĒpO(I@_@@,@AAp(AC$;(pw O(p@+Ppu,&@p,$ֈ@AAp(AOJ(p,@@@,\@p(p,p(pOp(piT @+Ppw\p,$ֈ@pp@@p@AAA_@@,4p@@p@GGGT p(pG$(po@ @AAptpplppppOĒ,p@@P p@ڒp(T pwO(T p{p@+Pppp(pOX(pR(pwI ,~(@G!OŒ,zp$;O,J!lp(pR(pOKT @+Ppw,< @o_@{o@@@pOT pO(P p$(pw$p@+Ppwv(pwm(pwd(dpBptpppdlp(,pO p$OŒ,zp$;pplp(p:OBbptpO(T pp,p$?(pFO(ڒpO(P pO(T pp@Ppptp$?(p$?(pO$?tpppڒ,hˀ(@wڒ,@p(pC!O=Œڒ,zp$;<pڒpڒ_,4{pP pP oOz,̀(p$(pO ,p(,p$(pOYŒ,zp$;(lpqT @+Ppdlp_pT I@_@@I@@@,0flT ,й(@wOvŒ,zp$;T ,&@T p(p,pT ,$ֈ@AAp(AOR@@@,\@p(p$T ,T p{O(T p<|O-(lpOŒ,zp$;{ |p{ ppp(dpOpppp(pG$(pw p$;<wp<w@@AA@Os@Pp(pKA@@AA@Os@,\ԯ@AAYp(AC Y@$Al(XpOn̒,z@$Al<*ZwBOq̒O(Oڒ,@AAڒp(ACڒ@$Al@$Al<Z <_Z{Z,9$Al<Z <_Z{t(0pM(Hps @@+@w5{(Hpws @@+@w{O̒,z@$AlZ,@AAppA@$AlZ XpTp ڒp< ڒO$->OϒO(OڒЖ,@Xp(XpC X@$Alڒ@?o{P$p=ڒ\p`p\@+Pp\@\AAQPp\p`p{p`p(`pOڒ@`@?o}Pw{{(`pO<ڒF`FF\p\@+Pp\@\AAQPp\p`p{ڠڒ,$ֈ@AAA,\ ڒAAHHAOA@Qp(@wOϒ,z@$Al ڒ@@AA@O@Pڒ, ڒ@@AA@Oْ@A(pOӒO(OڒЖ,@AAڒp(ACڒ@$Al(< ppp@$Al<Ĝw<Ȝpp@$Al,\o<ZwAڒ,ɀ@ڒp@@,mڒ@@pp$Al{B(dp,dI@_p@@Y,@ɀ@@,mpp@$Al< ZwZO$O(O屒Ж,@ڒp(ڒpCڒ@$Alڒ, Մ$AlԒKڒ,p,zȀpp@$Al<"Z$!POODԒOЖ,@AAڒp(ACڒ@$Al,\ԯ@AA ڒp(AC ڒ@$Alڒ,Ѓ@AAppA@$Al<1Z <0Z$SOΒOR OڒЖ,f@AA ڒp(AC ڒ@$AlO_ԒO(OڒЖ,@AA ڒp(AC ڒ@$Alڒ,&@ڒpڒ@+PpOڒ,z<1Zw,\DŽ$R(pG$=RAA@A@@@@AO\A(Qpw$=RpAA@A@@@@AA<Q$=RAA@A@@@@AO\AQOpԒ,x׈(@w$!RAA@A@@@@AO\AQOuԒ,x׈(@hAA@A@@@@AO\AQOzԒ,x׈(@6AA@A@@@@AO\AQOԒ,x׈(@w {oU,:ԅ,\⿄,\⿄z<G$R@@AA@O@(Pp!@@AA@O@P,,\AAHHAOA@Qp@@AA@O@(Pp-@@AA@O@POԒڒ,,\⿄@(ڒpw@@pp$Al,\ԯ@AAڒp(ACڒ@$Alppp@$Al<_Zw,@\$Al<_Zw,@\$Al<_Zw,@\$Al<_Zw,@\$Al<_Zw,@\$Al<_Zw,@\$Al<_Zw,@\$Al<_Zw,@\$Al<_Zw,@\$Al<_Zw,@\$Al<_Zw,@\$Al<_Zw ,@\$Al<_Zw,@\$Al<_Zw,@\$Al<_Zw,@\$Al<_Zw,@\$Al<_Zw,@\$Al<_Zw,@\$Al<_Zw@,\ԯ@AAڒp(ACڒ@$Al,pp@$Al<_Z$(dOؒO0ؒ OڒЖ,f@AA ڒp(AC ڒ@$Al,\ԯ@AAp(AC@$Alڒ,@AAppA@$Al<_Zw,\l$Al<_Z$d(0pX(Hp{ @@+@w{(Hpw{ @@+@w{ (4pw{O2ؒ,z@$Al<Ĝ<Ĝw<Ȝw{pp@$Al,\$Al<_Z$ve,\ԯ@AAڒp(ACڒ@$Al|ONؒк,֮@ڒpڒpAA@A@@@@AA, @AAppA@$Al<_Z$ f,\ԯ@AAڒp(ACڒ@$Al|OSؒк,֮@ڒpڒpAA@A@@@@AA, @AAppA@$Al<_Z$f,\ԯ@AAڒp(ACڒ@$Al|Oк,֮@ڒpڒpAA@A@@@@AA, @AAppA@$Al<_Z$iOO\ؒO(Ж,@AAڒp(ACڒ@$Alڒ@<@w$h<@G(@w$ph$i<@$iOjؒO( OЖ,f@AA ڒp(AC ڒ@$Al|pOxؒO0ؒ OЖ,f@ ڒp( ڒpC ڒ@$Altp,\ԯ@AA ڒp(AC ڒ@$Al(|pK (tpK{Oؒ,z@$Al(dpO<d|O d|p(hpO<htO htp|t,4@ ڒp ڒ@@@@AAppA@$Al,\ԯ@AA ڒp(AC ڒ@$Al,\D@ ڒp ڒ@@@@AAppA@$Al,\ԯ@AA ڒp(AC ڒ@$Al,\T@ ڒp ڒ@@@@AAppA@$Al<_Z$iOpɒɒOؒO(Ж,@AAڒp(ACڒ@$Alڒ@<@Kl@<@Wd@@$ْ,\$Al,\l$Al,\ф$Al,\ $Alڒ,ͷ$Al,\1$Al,\̯$AlOؒT,z@$Al<_Z$kppI@_,@@OؒO(O(ЖOI@_@@,@I@_@@OؒO@O(໒ЖO,@I@_,@@,@AAڒp(ACڒ@$AlI@_,@<@ĐwPĐppO໒O(O@Ж,@AAڒp(ACڒ@$Al{Đڒp,\ԯ@AA ڒp(AC ڒ@$Alڒ@<@"<@G(@ {9<_@{0pp{-pp{!pppp{ @$AlO ْ(pp Oْ@{ Oْ@@,zpp@{y<_Zwml\_,4OْO(Oڒ,@AAڒp(AC ڒ@{&O*ْl,zpp@{@{L H G F IppIsspڒڒp?s ?s{ڒp$nڒ@<@C$n@<@_$n@@$ڒ?sw ڒp$n?o[sw ڒp{v?oPs?o\s_??o_s_{5ڒp?o_sw#(ڒpw(ȜpĜpPڒp{)?/s_?o~sW ڒp{?s ڒp$n?/s_?o~sW ڒp{?sw ڒp$n??s_?o~sW ڒp{?sw ڒp$n?sw ڒp{R(Ĝp*<TڒPڒC0@Pڒ@sPpPڒp{!ĜpPڒp0@Ppڒp$n?o\sw*ڒp(Ĝp0@Pڒ@Pp@{^{Xڒp(ĜpGPڒ@@<Tڒ@C40@Pڒ@PpPڒp0@Pڒ@sPpPڒp@{L IILZA_AAYpڒI,{L IppI,O撀,IL IpppIO撀,(@w+On,xڒ,,\{L IHL,ڒI,YH_HHdpd@<@C$zr@<@_$zr@@$ ےڒI@ @@,O$ l@@AA@O@P,J!ڒOڒ,(ڒpO2ڒO撀,ڒ撀ڒ,< dw 撀p{ 撀p(`ڒpO璀撀,I$qp<dw ,G(ڒpQڒ ,@p,(pC%Oڒڒ,\@M,zڒp,\o(Dpw,Oڒ+{dp{{(dpw@{*Dے0璀p4璀p0璀AQ@0璀p{L IppIo@L p`ڒp,\>u(@OHے,z,l,,,pڒplڒpڒI@@@,@AA$p(AG($pC,,\@{ɠڒ,0ڒpHp,@hp(hpC@,\(DpwO_ے,zOK,,\H,,\<_h$x(,pw$x<$xO$pO(p,\Ak@@Obs,>@AAp(AwoO@<@$',ڒOO,,\6{3O@<@(%,ڒOO,,\z$x<w:(DpwO_ے,zOK,󈀠,r,\$x<w:(DpwO|ے,zOK,󈀠,4,\$x<w:(DpwOے,zOK,󈀠,,\F$x<w?(pw6p,ڒO,,\z$x<w>(p5p,ڒO,,\z$x<w(po@{_@@hp{a<w+Zp(<pw tڒp{?<w6(DpwOے,zOK,󈀠,,\A{z{(pohp+Op(p h,dc(p7h,@,p,@+Pp,@PAA,p,{$N~8hp(X pw+Zpw${k@@,4r@0p(0pw(Xڒpk@@,s@0p(0pw${4p(0pC4p00pXp{ Xp0p(0p<0${(0pw0OT,$ֈ@<w5+Opw @{ @<@<@{ (p{(p{<(O7 ,C@AA,dc(p ,fo(hphp{5k@@,C?@w (,p<w_,dck@@,C@AA,dc<@Ol(pa(p,@,o{@@,fo(p)lp( ppw < w lp@@,䰆{Oy,|tڒpdpzz,撀p,(ڒpU(pڒ ,@(p,((pC%Oڒ,\@M,zڒp<撀w dڒp<撀wĜptڒp,\o(dڒpO$<dڒO,\zՇ(@G ,\Hdڒp(\ڒp,l(p,O+pO㒀,o4璀p(4璀pK0璀@PHoH0璀p{,\@HoHHYp<@<@{p{p{{dp{Y@_@{L IpI(璀p&(pw (pw{O7𒀠Z,zpZ@+Pp'Z@PAA,dc(tpO t,`kZp{L IpHLpZAQ@@YpZp+@O,@HoHHap(璀p(? aa@@,fo? aw ,fo?Ya{{L H IppHLt,$ֈ@YpZ,$ֈ@HYHHdp(dpK5Z@d@tA?QPwZ@d@@tY,x׈(@w@{ dp{ʀ@{L H IppI,𸈀,,L IpppIL(璀pw{M(l蒀pwOl蒀O",J!(d蒀pwOd蒀O$,J!{<(l蒀pwOl蒀O(,J!(d蒀pwOd蒀O*,J!O\蒀O-,D@,!O蒀O8,D@,!O|蒀OB,D@,!OL,D@Yp(Ypw$QY@+Ppw$QpI@@@Y,J!(pw$Q I@@@,dp<dGRI@@dAAHH@(Ppw{;d@@AA@Oh@@I@@dAAHH@P,J!pdp{I@@@,J!L H IppILZT钀p,\OV(pw Oc@{ Oh@@,z(璀p2,\B@p@+PpOo񒀠,zT钀@<@C$@<@_$@@$H<`钀wOt,z{D<`钀w-O(pw O@{ O@@,z{O,zOK,󈀄@AA+A ,dc0蒀p$᠇O,zOK,󈀄@AA+A ,dc 0蒀p$᠇+pdO,zOYpY@+Pp5Y@PA!G@oW@+@O񒀄Y@PAA,zYp{ƠO,z{%(pw O@{ O@@,zO,z(0蒀pC oc0蒀p{\O!,z0蒀p{DO<,zOK,󈀄@AA+A ,dc 0蒀p(p,p(p,p(0蒀pC ob0蒀p@{L IppG_LlpppT蒀@(T蒀pw A,@@dpd,$ֈ@H,$ֈHA@A<_AOYOl,z,\(p,p(p,p@$¼Od򒀠,J!,\[(T蒀p$@@+@w$<蒀w (蒀pw{"<蒀$(蒀p${dhp@?oTPw$@?oPPw$@?otPw$@?opPw$hO򒀠,"(@$h@@?oTPw$h@@?oPPw$h@@?otPw$h@@?opPw$<蒀woT@{oP@@ph@PA!G@@+@@@,<ֈ@p,$ֈ<_@G;I@@@O򒀇@@,Od򒀄I@@@,J!(X钀pw hp(X钀p(hp${,\~0(@K$(璀pw$< 0蒀w$,GO\OH\钀,H@(@CuO,zO򒀠O\,z0蒀p(p,p(p,p,\@$¼hp< 0蒀TT钀p`钀p(璀p;,\B@p(hpw#@+PpO򒀠,z@@+@w$< 0蒀w$<蒀O蒀`p{@`p(H蒀pH蒀p{@p(pwOppp<O$̦(pO ,dc`,`kOvꒀ`,?@<@C@@,#@Xp(XpO$̦(璀pB(pO9O<O O%@{ O钀@@,zOK,,\]@p(@ <@{od,`k{;,\4k{2(,p ,\4k{ <w ,\H{,\.hpOK,󈀐pz(X钀p8(hp/ ,dc_,`k,𸈀,\]$p<蒀< 蒀wi<{^(蒀p蒀@+Ppp蒀lp{3@ @+@$@@A+Qpp@@lp$[<蒀< 蒀wf<{[(蒀p蒀@+Ppp蒀lp{4@o@@+@$@DA+Qpp@Dlp{_(蒀pwV(蒀p蒀@+Ppp蒀lp{1@(Hp$@HA+Qpp@Hlp(pw$訇p(pOrl`,,!@Xp(XpO{G(璀p4<O+O,<G O%@{ O钀@@,zp{,\]_,`kp(pOv`,, @Xp(XpO{G(璀p4<O+O,<G O%@{ O钀@@,zp{(XpG,@$¼$I< 0蒀w$IH蒀@(H蒀pw A@@p(p(,$ֈ(@O`,{@( p>@ ,$ֈ(@O( ,𸈀@ ,C,𸈀{< 0蒀,𸈀_,`k< 0蒀w$p( 蒀pn(蒀p(蒀@+Ppp蒀`,i{=@@+@.@LA+Qpp@L`,,{l(蒀p(蒀@+Ppp蒀`,{=@@+@.@PA+Qpp@P`,(pO(pFH,X@p(pC,OT,zO,zO,z(pOp(蒀pw$S(pK ( 蒀pw{O,z{l(蒀p(蒀@+Ppp蒀`,{=@@+@.@TA+Qpp@T`,{l(蒀p(蒀@+Ppp蒀`,{=@@+@.@XA+Qpp@X`,](p3(p*H,X@p(pCO3,z@@+@w$< 0蒀w$(蒀p$(蒀pw|(蒀pws(蒀pwj(蒀pwa(璀p OO[璀 ,{OOe ,O`,,$X< 0蒀w$Xp(璀pN(蒀p(蒀@+Ppp蒀`,'{p@l`, {L(蒀p(蒀@+Ppp蒀`,{p@p`,(pw$X(pH,X@p(pw$X(璀pw$X璀@<@Kw@<@Wo@@$蒀@(蒀pw At@@hp{G蒀@(蒀pw Ax@@hp{&蒀@(蒀pw A|@@hp{hp(hp1h@+Pp(h`,(pH,X(蒀phO钀p蒀@(蒀pwA@@p(p5@+Pp*`,k(pH,XO钀p蒀@(蒀pwA@@p(p5@+Pp*`,(pH,X<$ް蒀@(蒀pw A\@@p(pw O钀p@+PpE<蒀O `@{ A0@@,x(pH,X{Ol,z,𸈀$< 0蒀w$O钀p(pN@+PpC<蒀O `@{ A0@@,(pH,X@($pw$@$A+Qpw$@$<蒀O `@{ A0@@,wO4,@p ,𸈀@((p/@(A+Qp@(,_,,`k,𸈀,@@+@w$< 0蒀w$<_O _p( 蒀pOk(蒀pOb 蒀p( 蒀pK,\]@{L IGLpp(p,,:ɇ@GoGGYpY@@,? Yw{{p(Xp$j͇p<GI@@@AAQpp{p,ȇ@GoGGYpY@@,5ˇY@!GAA+Aw{I@@@AAYQpp? YI<GC,Ȅ@GoGGdpgYp? YI@@@AAYQppY@@,{I@@@AAQpGGGp<OHI@@@AAQ@!GAA+Aw(IA AA@@pIAAAHHXPpp{pI@@@AAQppI@@@,$ֈ<@OzI@@@,\@p@<@C$W͇@< @_$W͇@@$Xp$g͇Xp$g͇(璀pO,zXp0蒀p$g͇(璀pO%,zXp0蒀p$g͇(璀pO6,zXp0蒀p$g͇_,ȄXp$g͇(璀pOP,zXp0蒀p{x(璀pOb,zXp0蒀p{O(璀pOm,zXp0蒀p{&_` ,GȄXp{< O Xp{z<X$<·I@@@AA+Qpw$<·(璀pw$&·O},zI@@@AA?oRQwO,zI@@@AA?oLQwO,zI@ @@AA?oCQwO,zO},zOI@@@,L H G IpI L(璀pw$|χ(,p$|χOdpd@+Ppd@?oCPdp{d@?oCPwd@{@@Yphp(Ypw$|χYO,x׈(@$|χY,$ֈ<@G _,hp{/Y@@PA!G@@+@Y@@@,􉈀@hp<heh@ @p(@OZh@ @@,V(@COh,z{4hpXp(Dpw(7pwOh,zOO,b(@w0OO ,L(@wOO,6(@w{Xp$RԇOO,(@Xp$RԇOO$,(@+(p Xp{Xp0蒀p$RԇOO',(@Xp0蒀p$RԇOO2,(@Xp0蒀p$RԇOO>,V(@Xp0蒀p$RԇOOK,*(@Xp0蒀p$RԇOOP,(@Xp0蒀p$RԇOOZ,(@Xp0蒀p$RԇOO`,(@Xp0蒀p$RԇOOo,z(@Xp0蒀p$RԇOO,N(@Xp 0蒀p$RԇOO,"(@wOO, (@w{Xp$RԇOO,(@Xp0蒀p$RԇOO,(@Xp0蒀p$RԇOO,(@Xp$RԇOO,l(@Xp$RԇOO,I(@Xp0蒀p$RԇOO,(@wFOO,(@w0OO,(@wOO,(@w{((pw@{@@Xp0蒀p$RԇOO,(@Xp0蒀p$RԇOO,q(@Xp$RԇOO,N(@Xp$RԇOO ,*(@Xp!0蒀p{xOO,(@{`OO,(@{HOO ,(@{0OO%,(@{OO*,(@L IpppILYp(璀pw$WՇ< 0蒀w$WՇ,\@Yp(YpO' 0蒀p(璀pO/,z$UՇ(,p+0蒀p(璀pOB,z@$sՇ{p,\H@Yp(YpO# 0蒀p(璀pOc,z{?(Ypw(璀pOp,z{!0蒀p(璀pO,|{(璀pOp,zY@{L IHLdpp(蒀p (Hpw {@$ ؇( 蒀pC @$ ؇,\&a@dp(dpC @$ ؇dp(,p((pG @$ ؇(\钀pw((pO(\钀p(\钀pG @$ ؇(\钀pO\钀@@AA@Ox@Pp(pw @$ ؇,蒀@(,蒀pw A@@p@p蒀@(蒀pw A<@@lp(lpw O钀lpl@+Ppw @$ ؇,PP(@C @$ ؇hpp( 蒀pK,\{L H IpppILOX,$ֈ@YpOXO,й(@wY,C@AA,dc(TpO,o(p(pO,d$OXO,й(@4OXO,й(@OXO,й(@wA{,\4k(TpO,o(pO,d$(YpG$OXdpd@+Ppd@PAA,CdA@Qpdp{ܠOXY,a(Tp(pYOX,o(p)(p OXOX,$ֈ@,d(`pwD ,C@AA,dc(p#(p ,C@AA,䰆@{L IIp@{L IpppILpp,\#@YpOdO؇OއO,>(Ypw @{_,,`k{L IpILZXp(pC,\"[@pO\OH(,H@(@C2OXOO\,OX,|@$䇀@(Dpw(7pw(p@@Tp(Tpe<pO\pAA@A@@@@AA<QwTppAA@A@@@@AA<QwTp(TpOO\,z@(Hp(,p <{(Hpw(pw{@@(pXpXdpd@+Pp(OXd@PAA,@,وdp{Ӡ,S(@CO,z@$䇀,@Yp,\X@+Ppw$x䇀X@+Pp%X@PA!G@@+@ Xp{Ҁ\p,\k(\pwSX@Xp?-P$䇀,\,\A(@$䇀X@Xp?-P$䇀,\{pX@+Pp%X@PA!G@@Xp+@w{pX@+Pp%X@PA!G@@+@ Xp{,\vX@+Pp ,\(@{-zY,(TpO',z@{)Y,(TpO;,z@{L IIL(pw(Tpw$净,\&a@AAYp(AC$净<_YO_Yp,\Y@Yp(@Of,h@dp(Tp@O@gPpp(p+( ppw < dw{@O@gPpp{,\&{ ,\]L IpppI@{L IppI@{L IppI@{L IppI@{L IppI@{L IppI@{L IppIssp@{L IppI@{L IppColLYpdp(pw$U퇀dp<_dO$K퇀(dpK <1dO!{<_dO <_dO{<_d$E퇀OOH(dpK<1dGd@@A@AAAH@A@{\<_dO'<_dG dCoCChphAhAAAH@A@{0<_dw!dC_lCClplAlAAAH@A@{ H@_ @+pw$燀(Zpw$燀O(dpK <1dO{<_dO <_dO {<_d{qOG(dpK<1dGd@@AG@A@{L<_dO<_dGdAoAApG@@{(<_dwdA_lAApG@@{ G@_@P@{ O2@@,zYp(Zpw$K퇀OOF(dpK<1dGd@@A@AAAF@A@{b<_dO*<_dG#dCoCCpAAAAF@A@{3<_dw$dC_lCCpAAAAF@A@{ F@_ @+ pw$ 釀(Zpw$釀O:(dpK <1dO{<_dO <_dO {<_d{qOE(dpK<1dGd@@AE@A@{L<_dO<_dGdAoAA pE@ @{(<_dwdA_lAA$pE@$@{ E@_@P@{ O2@@,zYp(Zpw$K퇀OOD(dpK<1dGd@@A@AAAD@A@{b<_dO*<_dG#dCoCC(p(A(AAAD@A@{3<_dw$dC_lCC,p,A,AAAD@A@{ D@_ @+ pw$ꇀ(Zpw$pꇀOb(dpK <1dO{<_dO <_dO {<_d{wOhp(dpK<1dGd@@Ah@A@{O<_dO <_dGdAoAA0ph@0@{*<_dwdA_lAA4ph@4@{ h@_@P@{ O2@@,zYp(Zpw$K퇀OO8p(dpK<1dGd@@A@AAA8@A@{e<_dO+<_dG$dCoCC(pw (Dpwp<_ O$(hpw%(lpw(dp${,\&a(@C$񇀠,h@Ypdp(pwU(DpwL(pwO<,zp(pO%OK,zpOK,<dO\(pw8OM,z(pw (pw{O~,=,,Gp@$z{>pO$p{/pO$p{ pO$p{pO$p{{$:Z@O\DH{(XO\DH@@@,0H@<@G_"Mp@YL H G F E D C I;!Gw<Ewb;!G_W;!G0@{;!G7@{oW@@F\p>>>w3Gl@@ ,x׈(@wE,0F@L H G F E IFEY@@$,<$@E,0@L H G F E IppHZAtBxHl,wF$@O@<_ @w2(G"@bACB{GABG!t!w/!/!!\!!/!!\!!\*.txt*.c*.h*.r*.w*.cpp*.ksc*.bwr*.upd*.html*.htm*.mss*.tex*.nr[Mm]akefile*.hex*.hqx*.for*.f77*.f*.F*.s*.pas*.java*.el*.lisp*.sh*.perl*.awk*.sno*.spt*.sed*.TXT*read.me*READ.ME.**/.*%h%n%r%v%z%~%%%%%%%%%%%ƀ%̀%Ҁ%؀%܀%%䀐%ꀐ%%%&& &&&&!&'&0&9&<*.gz*.Z*.tgz*.gif*.tar*.zip*.o*.so*.a*.out*.exe*.jpg*.jpeg*.tif*.tiff*.pdf*.so.**.class*.rpm*.bmp*.bz2*.BMP*.dll*.doc*.vxd*.xl**.lzh*.lhz[wk]ermit'D'I'M'S'Y'_'e'i'n'r'x'~'''''''''''ŀ'ˀ'р''׀'݀'【' Internet Kermit Service ready at %s%s C-Kermit ready at %s%s %s login loopAccess denied. Login TimeoutInterrupt during initialization or command-line processing.C-Kermit quitting...cl_commands\%0 ` `%s %s-., telnetrloginiksdCan't initialize!rx %ssx %ssx -a %src %srbsb %ssb -a %srzsz %ssz -a %skermit -irkermit -rkermit -x{{./.readme}{README.TXT}{READ.ME}}Can't allocate i/o buffers!Can't open device: /dev/ttyCan't allocate packet buffers!can't initialize i/oC-Kermit library, 7.0.009, 29 Nov 1999+NULSOHSTXETXEOTENQACKBELBSHTLFVTFFCRSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCFSGSRSUS+4+8+<+@+D+H+L+P+T+W+Z+]+`+c+f+i+l+p+t+x+|+++++++++++XXXBPHNBHINDNELSSAESAHTSHTJVTSPLDPLURISS2SS3DCSPU1PU2STSCCHMWSPAEPASOSSCICSISTOSCPMAPCNBS,(,(,,,0,4,8,<,@,D,H,L,P,T,X,[,_,c,g,k,o,s,w,z,~,,(,,,,,,,DELSHY*.~[0-9]*~0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ-10ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=>?456789:;<=  !"#$%&'()*+,-./01238P8n8n8n8n8n8n8n8n8n8n8n8n8n8n8n8n8n8n8n8n8n8n8P8n8n8n8n8n8n8n8n8n8n8]8n8]evenoddmarkspacenoneinvalid%02ld:%02ld:%02ldUNIX Communications support, 7.0.231, 31 Dec 19997D AT&T 3B2 System V7|/dev/tty7none7LINESCOLUMNSFatal: setuid failure. Fatal: setgid failure. Fatal: C-Kermit setuid to root! /dev/null%s is not a terminal device Locked by process %d %d%s %sCan't unset O_NDELAYioctl(TCSETA)setuphangupresetclose:䀐:ꀐ::Warning, problem releasing lock ?WARNING - close failed: %s Removing stale lock %s (pid %d terminated) /usr/spool/uucp;LCK..%s%s/%s%s/LTMP.%05dUUCP not installed or Kermit misconfigured Warning - Lockfile %s seized by pid %d Warning - Can't remove lockfile: %s Warning - Can't remove secondary lockfile: %s RƀR R R R R R R RR RԀR R R RUVVVVVVVVVVVVVV[[[[[[À[ˀ[Ӏ[ۀ[　[뀀[[\\ \^%c... Canceled... Can't send BREAKHZ%s%s %s :UNIX File support, 7.0.156, 30 Dec 1999K AT&T 3B2 System VKDrm -f K\cp Khmv Kppwd Kxls -l KKcat KMailKlpKdf KKwho K /usr/adm/wtmp/var/log/iksd.logTerminal input not allowedrwa*%.24s %d %s %ld %s %c %s %c %c %s %s %d %s _ikskermit %c/dev/nullzchko: Malloc error 46 ..%sNONAME.././HOME/bin/shSHELL-c.~*~.~%d~/----------%oU1%04d%02d%02d %02d:%02d:%02d;Zx0Nက5ကကnကကကကechoSD%s %s'**fgen can't malloc string space LOGNAME?Privilege cancellation failure sh-i/.////../?Local resource failure: malloc ftpanonymous/usr/bin/bash/etc/ftpusersxxiks_%04x(unknown host)anonymous:Anonymous login. User %s logged in. USER=%sLOGNAME=%sHOME=%sC-Kermit functions, 7.0.187, 20 Dec 1999|DisabledLocal onlyRemote onlyEnabled|䀐|퀐|}}(-b4)Lz hM]pU6Z Q~"#In'+Af/T=23uV7J;,}?PCtiGx KXaOdRS$Y^W(j[쑖_!cgl*kNo1rs yw9{& ȡDH٪>@£F꫼mqʻ\v0B`%:< Ӥ|ߴe8E.5Error receiving file~8%cfnlist: no memory for cmargbufstdinCalibrationToo many files match wildcardCancelledRead access deniedFile is not readableNo files matchFile not foundɀӀCALIBRATENONAMEAccess deniedException listWrite access denied!%s?Sorry, receive filter + filename too long, %d max. Name too long/dev/nullCan't append to a directoryCan't rename existing directoryCan't overwrite existing directoryFile has same name as existing directoryCFILE%02ld?Sorry, send filter + filename too long, %d max. Recovery attempted in TEXT mode: %sDN9D7CALIBRATION?Internal error expanding ADD list . |䀐|䀐}}Client Command Status Description REMOTE LOGIN required GET %-14s%s Transfer file(s) from server to client. SEND %-14s%s Transfer file(s) from client to server. MAIL %-14s%s Send file(s) as e-mail. REMOTE ASSIGN %-14s%s Assign value to server variable or macro. REMOTE CD %-14s%s Change server's directory. REMOTE COPY %-14s%s Copy a file on the server. REMOTE DELETE %-14s%s Delete a file on the server. REMOTE DIRECTORY %-14s%s List files on the server. REMOTE EXIT %-14s%s Exit from Kermit server program. REMOTE HOST %-14s%s Execute a shell command on the server. REMOTE PRINT %-14s%s Send a file to the server for printing. REMOTE QUERY %-14s%s Get value of server variable or macro. REMOTE MKDIR %-14s%s Create a directory on the server. REMOTE RMDIR %-14s%s Remove a directory on the server. REMOTE RENAME %-14s%s Rename a file on the server. REMOTE SET %-14s%s Set a parameter on the server REMOTE SPACE %-14s%s Inquire about disk space on the server. REMOTE TYPE %-14s%s Display a server file on your screen. REMOTE WHO %-14s%s List who is logged in to the server. FINISH %-14s%s Return the server to its command prompt. BYE %-14s%s Log the server out and disconnect.***܀++H+v++Ҁ,,.,l,,؀--4-b---쀁.&.eREMOTE HELPC-Kermit %s,%s Internet Kermit Service (EXPERIMENTAL) type*.~[0-9]*~0000-00-00 00:00:00%10s%-10s %s %s %-10s %s %s %10s%10ld %s %s%s%s -> %10ld %s %s%s%s %sSummary: %ld director%s, %ld file%s, %ld byte%s%syiess./*Listing files: %s%s%s*/*DIRECTORY %sDIRECTORY %10s: %s%sskippingdeleted directory: %s%s%s%ld file%s deleted, %ld byte%s freed%sDeleting "%s"%sREMOTE DELETE===؀=BBB>&B>M>tBB>B>€=BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB>送==؀=BBB>&B>M>tBB>B>€=BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB??5?fBBBBBBB@@@9@U@q@BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB@A AyAABB!BBBB~BBBBBBBBBBL3N3 !"$'(+-.03569:Retransmission(resend)Draining incoming packets, wait...Drain complete.String too longGET Packet Internal Error 1GET Packet Too Long for ServerGET Packet Internal Error 8@ GET Packet Internal Error 9Send Packet FailureGET with no filenameGET Packet Internal Error 2Ox%dGET Packet Internal Error 3GET Packet Internal Error 4Mx%dGET Packet Internal Error 5GET Packet Internal Error 6GET Packet Internal Error 7B00receive /protocol:zmodemset proto kermit, server, set protocol gset proto kermit,server,set proto xmodemset proto kermit,server,set proto xmodem-crcset proto kermit,server, set protocol yset proto kermit,server,set proto zmodemserverreceive /protocol:kermituRtuu&t䀁u<Bad packet headerBad packet lengthBad sequence numberChecksum errorCRC error(crunched)~8%c-xx-%02d-%c-%02d-%02d- W#Z#Zini_pkts: no memory for s_pkt%ld%dsizetypedatecreatoraccountareapasswordblocksizeaccessencodingdispositionprotectionoriginformatsys-dependent23456789:;<=>name@䀐逐󀐠"+77BIP䀐^`bdfhjlnprtvx} unknowngtattr: no memory for dsbufgattr: no memory for spbufN+N? 送򀁢CހbDCan't create backup fileCan't open output fileAccess deniedCommand or pipe failureCan't open fileCan't close fileWart Version 2.14, 10 Nov 1999C-Kermit Protocol Module 7.0.134, 31 Dec 1999DSERVERUser cancelledError sending stringLogin requiredDeleting files is disabledBadly formed server commandREMOTE HOST disabledHOST commands not availableCan't do system commandDid you say RECEIVE instead of GET?Unimplemented server functionREMOTE CD disabledREMOTE CDCan't change directoryREMOTE TYPE disabledREMOTE DIRECTORY disabledREMOTE DIRAccess deniedNo files matchCan't list directoryREMOTE DELETE disabledREMOTE DELETEIt's a directoryFile not foundDELETE failedSERVER FINISHFINISH disabledREMOTE EXITEXIT disabledSERVER BYEBYE disabledREMOTE HELPCan't send helpREMOTE SETREMOTE SET disabledUnknown REMOTE SET parameterREMOTE TYPECan't type fileREMOTE MKDIR not availableREMOTE RMDIR not availableREMOTE SPACE disabledREMOTE SPACECan't check spaceREMOTE WHOREMOTE WHO disabledCan't do who commandQUIT disabledUnimplemented REMOTE commandCan't open windowRECEIVEXZError writing dataCan't create fileCan't print fileCan't mail fileCan't delete temp fileCan't close fileRESEND capabilities not negotiatedSENDCan't execute commandCan't open fileCan't send attributesUnknown errorProtocol errorERRORUnexpected packet type݀݀߀ۀ׀送рItJNԀ#yɯSͩ$ЗҷBmـB^yۀ=ր("W򹀁=:c4lπJsGV[ s ܀πRՀՀՀIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIIIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII8IIG4IIIIIIIIIIIIIIIII5IIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII6II7GIIIIIIIIIIIIIIIIIIII:IIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII9GIIIIIIIIIIIIIIIIIIIIIIIIII=IIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIAIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIBIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIDIIIIIII IIII IIIIICIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIEIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIFIIIIIII IIII IIIIIHIII IIIIIII    11111111111111111111111111111111 1!"#1&1(%11111')*-/.$11111111 1,11 11+110111 1111111IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIII IIIIIIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIG4IIIIIIIIIIII IIII53IIIIIII IIII IIIII2III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIII IIIIIIIIIIIII IIII IIIIIHIII IIIIIII%s -s %c%s%c %s%s %sREMOTE QUERYREMOTE QUERY disabledCan't get valueValue too longCan't send valueREMOTE ASSIGN disabledREMOTE ASSIGN failedREMOTE COPY disabledREMOTE COPYCan't copy fileREMOTE RENAME disabledREMOTE RENAMECan't rename fileAlready logged in.REMOTE LOGOUTLogged outUsername too longLogged in as guest - restrictions applyLogged inAccess denied.Logout ignoredLogin ignored.Logout ignored. IKSD IDLE TIMEOUT: %d sec SERVER IDLE TIMEOUT: %d sec SERVER DISCONNECTSEND disabledproto set binary modeA Kermit server is not available proto reset binary mode?No connection Sorry, you must 'set speed' firstCan't open lineCan't condition lineCarrier required but not detectedsrgcjhk Sorry, only Kermit protocol is supported in this version of Kermit KERMIT READY TO SERVE...Entering server mode on Type Ctrl-C to quit.Return to your local Kermit and give a SEND command.KERMIT READY TO RECEIVE...Return to your local Kermit and give a RECEIVE command.KERMIT READY TO SEND...Return to your local Kermit and give a SERVER command.KERMIT READY TO GET...KERMIT READY TO SEND SERVER COMMAND...C-Kermit server doneGET disabledUnknown GET ParameterGET without filenameKLLLLLKLLLLLLKLKNCommand package 7.0.121, 24 Dec 1999aprilaugustdecemberfebruaryjanuaryjulyjunemarchmaynovemberoctoberseptember(.5 >GOTY_c l t Command? @ /%s%s:%s %s%s%s ?Memory allocation failure ?Name too long - %s %sfatal error: unable to allocate command bufferscmpush: no memory for cmpcmnum: illegal radix - %d Output file?Name too long ?Wildcards not allowed - %s /dev/tty?Write permission denied - %s ?Default name too long IKSD IDLE TIMEOUT: %d sec ?Timed out Command or field too long Expanded name too long ?cmifi: malloc error ...?Wildcard matches more than one directory /?No %s match - %s directoriesfiles?Too many %s match - %s ?Not a directory - %s ?Read permission denied ?Read permission denied - %s ?File not readable - %s ?File not found - %s %s Default name too long %c %s?Partial name too long ?Directory name too long ?Completed name too long Directory name Input file specification %s?Expanded name too long : %s , one of the following: mOmҀҀҀҀmʀҀmʀmʀm䀂m䀂v~t?Default too long Value too long Please complete this field %s%s̀ۀۀۀۀ䀂䀂ՀU Text string?Unexpected return code from gtword() - %d !ррррр~?Keyword table missing Evaluated keyword too long ?Not a switch - %s ?Ambiguous - %s ?No keywords match - %s ?No keywords match - "%s" %s:?Evaluated keyword too long No keywords match One of the following: %s, one of the following: or the name of a macro ("do ?" for a list) or the token %c or one of the tokens: %s %d - Unexpected return code from gtword qހπ쀂쀂쀂쀂}ဂdaysmonthsweekswksyearsyrs*/6<@F00+-TtYy 00:00:00%04d%02d%s%04d%stodaytomorrowyesterday%02d%s%s%02d%s%s%02d %02d:%02d:%02dY怂}Date and/or time?Evaluated date too long Invalid date or time - "%s" Oops, command recall error ?Not confirmed - %s Press the Return or Enter key to confirm the command A&&&&O&OOX?cmfdb - unexpected function code: %d Does not match filename or switchDoes not match filename or keywordNot a number or valid keywordNot a number or valid switchNot valid in this position?%s: "%s" e瀂'[ڀĀ倂?Saved word too long ?Field too long error 1 ?Field too long error 2 ?Too long #3 ?Too long #4 %s %s%s?Command too long, maximum length: %d.  yyyyyyyyyy̝̝̝̝̝̝̝̝̝̝ū̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̓ū̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̝̓Trustees of Columbia University in the City of New York. Press ? for a list of commands; see documentation for detailed descriptions. DOCUMENTATION: "Using C-Kermit" by Frank da Cruz and Christine M. Gianone,2nd Edition, Digital Press / Butterworth-Heinemann 1997, ISBN 1-55558-164-1.To order: +1 212 854-3703 or +1 800 366-2665. PLEASE PURCHASE THE MANUAL.It shows you how to use C-Kermit and answers your questions; sales of thisbook are the primary source of funding for C-Kermit development and support.More info at the Kermit Project website, http://www.columbia.edu/kermit/.p˪D̑܀'t;Syntax: ARRAY verb operands...Declares arrays and performs various operations on them. Arrays havethe following syntax: \&a[n]where "a" is a letter and n is a number or a variable with a numeric valueor an arithmetic expression. The value of an array element can be anythingat all -- a number, a character, a string, a filename, etc.The following ARRAY verbs are available:[ ARRAY ] DECLARE arrayname[n] [ = initializers... ] Declares an array of the given size, n. The resulting array has n+1 elements, 0 through n. Array elements can be used just like any other variables. Initial values can be given for elements 1, 2, ... by including = followed by one or more values separated by spaces. If you omit the size, the array is sized according to the number of initializers; if none are given the array is destroyed and undeclared if it already existed. The ARRAY keyword is optional. Synonym: [ ARRAY ] DCL.ARRAY SHOW [ arrayname ] Displays the contents of the given array. A range specifier can be included to display a segment of the array, e.g. "array show \&a[1:24]." If the arrayname is omitted, all declared arrays are listed, but their contents is not shown. Synonym: SHOW ARRAY.ARRAY CLEAR arrayname Clears all elements of the array, i.e. sets them to empty values. You may include a range specifier to clear a segment of the array rather than the whole array, e.g. "array clear \%a[22:38]"ARRAY SET arrayname value Sets all elements of the array to the given value. You may specify a range to set a segment of the array, e.g. "array set \%a[2:9] 0"ARRAY DESTROY arrayname Destroys and undeclares the given array.ARRAY RESIZE arrayname number Changes the size of the given array, which must already exist, to the number given. If the number is smaller than the current size, the extra elements are discarded; if it is larger, new empty elements are added.ARRAY COPY array1 array2 Copys array1 to array2. If array2 has not been declared, it is created automatically. Range specifiers may be given on one or both arrays.[ ARRAY ] SORT [ switches ] array-name [ array2 ] Sorts the given array lexically according to the switches. Element 0 of the array is excluded from sorting by default. The ARRAY keyword is optional. If a second array name is given, that array is sorted according to the first one. Switches: /CASE:{ON,OFF} If ON, alphabetic case matters; if OFF it is ignored. If this switch is omitted, the current SET CASE setting applies. /KEY:number Position (1-based column number) at which comparisons begin, 1 by default. /NUMERIC Specifies a numeric rather than lexical sort. /RANGE:low[:high] The range of elements, low through high, to be sorted. If this switch is not given, elements 1 through the dimensioned size are sorted. If :high is omitted, the dimensioned size is used. To include element 0 in a sort, use /RANGE:0 (to sort the whole array) or /RANGE:0:n (to sort elements 0 through n). You can use a range specifier in the array name instead of the /RANGE switch. /REVERSE Sort in reverse order. If this switch is not given, the array is sorted in ascending order.Various functions are available for array operations; see HELP FUNCTION fordetails. These include \fdimension(), \farraylook(), \ffiles(), \fsplit(),and many more.耐Mclη?hϝ䀐-qлPєѭ>҇Ҷ̀[ӑӫ6Nyԗ߀*sՌրO֚တ.M^׫ހ쀐;Fx،׀!nٸ&1~ږ‐.;Syntax: COPY [ switches ] file1 file2 Copies the source file (file1) to the destination file (file2). If file2 is a directory, this command copies file1 under its own name to the given directory. Only one file at a time may be copied; wildcards are not supported. Switches: /LIST Print the filenames and status while copying. Synonyms: /LOG, /VERBOSE /NOLIST Copy silently (default). Synonyms: /NOLOG, /QUIET /SWAP-BYTES Swap bytes while copying. /FROMB64 Convert from Base64 encoding while copying. /TOB64 Convert to Base64 encoding while copying.܄ܪB݉ݡݩ5Calޜޥ;Command-line options are given after the program name in the systemcommand that you use to start C-Kermit. Example: kermit -i -s oofa.exetells C-Kermit to send (-s) the file oofa.exe in binary (-i) mode.Command-line options are case-sensitive; "-s" is different from "-S".If any "action options" are included on the command line, C-Kermit exitsafter executing its command-line options. If -S is included, or no actionoptions were given, C-Kermit enters its interactive command parser andissues its prompt.Command-line options are single characters preceded by dash (-). Somerequire an "argument," others do not. If an argument contains spaces, itmust be enclosed in doublequotes: kermit -s "filename with spaces"An option that does not require an argument can be bundled with other options: kermit -Qis oofa.exeExceptions to the rules: . If the first command-line option is a filename, Kermit executes commands from the file. Additional command-line options can follow the filename. . The special option "=" (equal sign) or "--" (double hyphen) means to treat the rest of the command line as data, rather than commands; this data is placed in the argument vector array, \&@[], along with the other items on the command line, and also in the top-level \%1..\%9 variables. . A similar option "+" (plus sign) means: the name of a Kermit script file follows. This file is to be executed, and its name assigned to \%0 and \&_[0]. All subsequent command-line arguments are to be ignored by Kermit but made available to the script as \%1, \%2, ..., as well as in the argument-vector arrays. The initialization file is not executed automatically in this case. . The -s option can accept multiple filenames, separated by spaces. . the -j and -J options allow an optional second argument, the TCP port name or number.Type "help options all" to list all the command-line options.Type "help option x" to see the help message for option x.C-Kermit also offers a selection of "extended command-line" options.These begin with two dashes, followed by a keyword, and then, if the optionhas arguments, a colon (:) or equal sign (=) followed by the argument.Unlike single-letter options, extended option keywords aren't case sensitiveand they can be abbreviated to any length that still distinguishes them fromother extended-option keywords. Example: kermit --banner:oofa.txtwhich designates the file oofa.txt to be printed upon startup, rather thanthe built-in banner (greeting) text. To obtain a list of availableextended options, type "help extended-options ?". To get help about allextended options, type "help extended-options". To get help about aparticular extended option, type "help extended-option xxx", where "xxx"is the option keyword.At present, most of the extended options apply only to the Internet KermitService Daemon (IKSD). Type "help iksd" for details.(lߞߵ>Ҁ,sὀ߀Pfˀ_㩀A䈀Ԁg岀р_r氀뀐0|À]臀袀퀐1z鿀j; %s, Copyright (C) 1985, 2000, %s %s passwordpromptuserid allcautiousminimalnone8<EMprefixedunprefixednewolddiagnosticserrorpacingspecial-escapes 1234blank-free-28:<>@countsprefixautomaticoffonquietverbosesessiontimestamps@Hfullhalf/direct-serial/modem/remotekeepxon/xoff  M bellcodecresclfxoffxonX]b ei Mlqasciibinarydebugtextcinternationallocallong-distance$Maskdcapabilitiescarrier-watchcommandcompressiondata-compressiondial-commanderror-correctionescape-characterflow-controlhangup-methodkermit-spoofmaximum-speednamespeakerspeed-matchingtypevolume  #160>MR1highlowmedium,15at-commandsdcechardware-flowhwfcitukssbsoftware-flowspeed-bufferingswfctbtelebitv25bis-commands`lor @@area-codeconfirmationconnectconvert-directorycountry-codedirectorydisplayforce-long-distancehangupignore-dialtoneintervalininit-stringintl-prefixintl-suffixlc-area-codeslc-prefixlc-suffixld-prefixld-suffixlocal-area-codelocal-prefixlocal-suffixmmacromemethodmnp-enablemodem-hanguppbx-exchangepbx-inside-prefixpbx-outside-prefixpulse-countriesrestrictretriessortstringsuffixtesttimeouttf-area-codetf-prefixtoll-free-area-codetoll-free-prefixtone-countries)  / 2$'3?K.Y,c-mw ,-4 3!"# 5* (%>-4$;7@H&U'_&s'66modem-commandrs232-signalv24-signal .;autoanswerdial-mode-promptdial-mode-stringhangup-commandno-flow-controlpredial-initpulsetonel w r ' 6Rautorts/cts M default kermitshell/match-dot-files/no-match-dot-files8Ievenhardwaremarkoddspacexe}HmMosxeomessagepath$,filePon-disconnectstatuswarningalwaysremotediscard444echoautodownloadbytesizecbreakheightinterruptionmore-promptingquotingrecall-buffer-sizeretrywidth l   (;A cd-messageget-pathidle-timeoutkeepalivelogin@cancellationPcrc-calculationlocking-shiftmodepipesprotocolslow-startXPl |  manualDforceddacceptedrefusedreqrequrequerequesrequestrequesterequestedrequired binary-me-means-u-toobinary-u-means-me-tooinfinite-loop-checksb-implies-will-do\rbinary-modenvtrawcr-lfcr-nulb 4 :ibbibinbinabinarbinary-binary-transfer-modebinary-xfer-modebugnawsnewline-modeno-encrypt-during-xferprompt-for-useridremote-echoterminal-typewait-for-negotiations                ) 7authenticationcom-port-controlencryptionforward_xibm-saklflownew-environmentpragma-heartbeatpragma-logonpragma-sspisaksend-locationsgastart-tlssuppress-go-aheadsttypexdisplay-location \ k |             )   /client/server < Dcharacter-setscyrilliccx-logdialdynamic-memoryfile-transferforwardfullscreen-displaygreekhebrewhelpiksdif-commandjob-controlkanjikerberoslatin1latin2making-connectionsnetworkntlmptypushredirectscript-commandserver-modeshow-commandsrpssl/tlstransmitunicodexyzmodem h w       "*/38AP\imu~$calibratedisknowhereprinterscreenPZ_go\v(home)Names of one or more directory files, separated by spacesDirectory name?Wildcards not allowed ?Not a directory - %s ?Internal error - malloc ?Too many directories - %d max username"%s" - too long, %d max accountCarrier wait timeout, seconds0nookquityes Please respond Yes or No%s or Quit push%s available not CHECK: push not available pipes%s available CHECK: pipes not available %s%s available CHECK: %s not available E= No record. No connection. ActiveClosedUnknown Status: %s Opened: %s User: %s PID: %s Type: %s To: %s From: %s Device: %s Origin: %s %s Elapsed time: %s (unknown) Encrypted: %s YesNo Log: %s (none)适Հ㽀 %s %s T=SERIAL H=%s D=%s LOGLINE BUFFER OVERFLOWWARNING: modem info for "%s" not filled in yet This space available (use SET MODEM NAME)Modem parameter?No keywords match: "%s" how to hang up modemcapability of modem?value required modem typebased on existing modem typeunknownDescriptive name for modemUnexpected SET MODEM parameter €݀,퍀]uModem initialization stringTelephone number prefixDialing command for modem, include "%s" to stand for phone number, for example, "set dial dial-command ATDT%s\13"?Dial-command must contain "%cs" for phone number. Seconds to wait for call completionKermit/modem timeout differential10ASCII value of character to escape back to modem43Modem's command to %sable %sendisModem's hangup commandModem's command to enable hardware flow controlModem's initialization stringModem's command to disable local flow controlTelephone number prefix for dialingModem's command to enable local software flow controlCommand to configure modem for tone dialingCommand to configure modem for pulse dialingCommand to enter dial modeModem response upon entering dial modeCommand to turn modem speaker onCommand to turn modem speaker offCommand for low modem speaker volumeCommand for medium modem speaker volumeCommand for high modem speaker volumeCommand to tell modem to ignore dialtoneCommand to send to modem just prior to dialing?Unexpected SET DIAL STRING parameter Number of times to try dialing a numberSeconds to wait between redial attempts30Area code you are calling from?Sorry, area code must be numeric (please omit the parentheses) (no slashes, please) Country code you are calling from?Sorry, country code must be numeric (please omit the plus sign) 0118008888778660033International dialing prefixInternational dialing suffixLong-distance dialing prefixLong-distance dialing suffixLocal dialing prefixLocal dialing suffixInternal-call prefix of PBX you are calling from\v(d$px)\v(d$pxx)\v(d$p)Outside-line prefix of PBX you are calling from Telephone number suffix for dialingToll-free area code(s) in the country you are calling fromExchange(s) of PBX you are calling fromAnother toll-free area codeAnother PBX exchange Long-distance prefix for toll-free dialingArea code to which calls from your area are localMilliseconds to pause between each character sent to dialerName of macro to execute just prior to dialingCountry code where Pulse dialing is requiredCountry code where Tone dialing is availableAnother country code?Unexpected SET DIAL parameter }BBr򷀂򣀂懲ŀ񡀃ƀ。 M*䀂r€䀃E]BZjހ%%^v􎀂ր%6N\t #;Sorry, command disabled %s Modem carrier-watch: off on auto unknown Modem capabilities: (none) AT ITU SB EC DC HWFC SWFC KS TB Modem maximum-speed: %ld bps (unknown) Modem error-correction: %s Modem compression: %s Modem speed-matching: %s (interface speed %s) changesis locked Modem flow-control: none xon/xoff rts/cts Modem hangup-method: %s Modem speaker: %s Modem volume: %s Modem kermit-spoof: %s Modem escape-character: %d (= "%c") MODEM COMMANDs (* = set automatically by SET MODEM TYPE): %c Init-string: %c Dial-mode-string: %c Dial-mode-prompt: %c Dial-command: %c Compression on: %c Compression off: %c Error-correction on: %c Error-correction off: %c Autoanswer on: %c Autoanswer off: %c Speaker on: %c Speaker off: %c Volume low: %c Volume medium: %c Volume high: %c Hangup-command: %c Hardware-flow: %c Software-flow: %c No-flow-control: %c Pulse: %c Tone: %c Ignore-dialtone: %c Predial-init: For more info: SHOW DIAL and SHOW COMMUNICATIONS Modem info for "%s" not filled in yet No modem selected, so DIAL and most SET MODEM commands have no effect. Use SET MODEM TYPE to select a modem. %ld - illegal value, must be 0 or positive Internal time conversion error, sorry. %05ld8:7E17E27M17M27O17O27S17S28E18E28N18N28O18O2&@&D&H&L&P&T&X&\&` &d &h&l &p &t &@&D&H&L&P&T&X&\&h&`&d&l&p&tpurge'hM&gotherxxmodemxmodem-crcyymodemymodem-gzmodem''''''''' {%s}?Sorry - maximum length is %d ?Sorry, REDIRECT capability required for external protocols. Optional command to send to host prior to uploading in binary modeOptional command to send to host prior to uploading in text modeOptional command to send to host to start Kermit serverExternal command to SEND in BINARY mode with this protocolExternal command to SEND in TEXT mode with this protocolExternal command to RECEIVE in BINARY mode with this protocolExternal command to RECEIVE in TEXT mode with this protocol|lprPrinter or file name?Directory names not allowed Sorry, printing disabled ?Memory allocation failure ?Access denied - %s ...Use SET SEND or SET RECEIVE instead. Type HELP SET SEND or HELP SET RECEIVE for more info. 310Send buffer size?Buffer size required ?Negative numbers can't be used here ?Integer overflow, use a smaller number please ?Too small Receive buffer size%d400/client, /server or?This switch does not take arguments ?Unexpected value - %d desired server stateUNKNOWNdesired client stateparameter for TELNET negotiationsinitial TELNET echoing stateterminal type for TELNET connectionsDOacceptWILLu?Sorry, command disabled. Prompt string%% fields are not used in this command. Positive number?A positive number, please bytesize for command characters, 7 or 87 ?The choices are 7 and 8 maximum number of commands in recall bufferCommand screen width, characters80Command screen height, rows24?Sorry, debug log feature not enabled Number of seconds before starting to send5EXIT status codeFlow control type, one of the following: keep none xon/xoff or connection type?No keywords or switches match: "%s" Flow control typeASCII value?Character must be in ASCII control range Maximum retries per packet403Number of seconds, or 0 for no idle timeoutInterval for server NAKs, 0 = none ?Specify a positive number, or 0 for no server NAKs 404Name of file420type of fileTransmission rate for %s in bits per second?Sorry, you must SET LINE first ?Speed cannot be set for network connections ?Unsupported line speed - %ld ?SET SPEED fails, speed is %ld %s, 75/1200 bps %s, 134.5 bps %s, %ld bps character-setASCII code for cancellation characterCancel character must be in ASCII control range How many required to cause cancellationNumber must be 2 or greater ?Sorry, only Kermit protocol is available 410Sorry, access to pipes is disabled who expands wildcardswhether to match filenames that start with "."Shell expansion is disabled Window size for Kermit protocol, 1 to 32Window size for ZMODEM protocol, 0 to 65535Window size for current protocol?SET WINDOW does not apply to %s protocol 406 Adjusting receive packet-length to %d for %d window slots OUTPUT command parameterMilliseconds to pause between each OUTPUT character100control-character prefixing option?Internal error - malloc failure Numeric ASCII value of control character that needs NO prefix, or the word "all", or carriage return to complete the list Numeric ASCII value of control character that MUST BE prefixed, or the word "all", or carriage return to complete the listala XON/XOFF characters 17, 19, 145, 147 not affected. SET FLOW NONE to transmit these characters unprefixed. TELNET IAC = 255, CR = 13, not affected. ?Please specify a number or the word ALL ?Values allowed are: %d-31, 127-159, 255 Sorry, not while Xon/Xoff is in effect. Sorry, not on a TELNET connection. repeat-count compression parameter(not implemented yet, nothing happens) ?Illegal value for prefix character Seconds from now, or time of day as hh:mm:ss?Number, expression, or time of day required ?Alarm time is in the past. Sorry, arithmetic overflow - hh:mm:ss not usable on this platform. value for login scriptSorry, too long Name of temporary directoryCD PATH stringStop bits for serial deviceSerial device character size, parity, and stop bitsfor commandTime limit for ASK command, secondsNot implemented - %s ӀހހހހހހрӀހހӀӀӀހހހހހހހހހӀހހހހ%%&#%&#%%%%ǀ%΀&#%Հ%܀%〃&#%ꀃ%n%x%&%& &&#&#&#&&#%@2@䀃ADF"HHHHD@HHEbFHHHHHHHHCGCH@€FÀF̀F׀FဃWXW:XXXȀZK[[=[p[]ccc\\cccc_7ccccccccccc\_caaaŀbbbbbɀbq}qz7z7z7rvz7z7z7z7z7z7z7z7z7z7z7z7rrz7sgz7sрz7tKz7z7tz7vGvڀvƀxy3yGyz7z7z7yyzz7z'* A network connection to %s might still be active. An incoming network connection might still be active. A serial connection might still be active on %s. OK to close? OK to exit? control quote = %d, applied to (0 = unprefixed, 1 = prefixed): %3d: %d %3d: %d 127: %d 255: %d SET SEND DOUBLE characters: %d SET RECEIVE IGNORE characters: 0123456789ABCDEFSunMonTueWedThuFriSat<<<<<<=G=Q=Z=e=o=z===,=0==&==_===:=9=;=h=h=<=====>\>[>$>$>/>8>B>H>N>T>Z>`>f>lA>un>|p>o>U>V>}>8> >b>c>>>)>s>>>>?!? "?S?? R?)~?0?7^?A?H ?M?S?[?c?l?r/?y?7?G?H?E?D?C?G?F?K?M?L?J?B??N??@@@@#@-O@4@9@?@D+@L@R@Y@c@mY@w#@~>@d@a@ @|@@?@@@f@e@g@4@ @-@x@@@A5A A1A A .A)tA.A6A=ADAIQAPyAXA^AdAjAp=AwAZAuAwAAAAmAXaaconvertabsolutearraylookb64decodeb64encodebasenamebreakcacapcapitalizecapscharacterchecksumcodecommandcontentscvtdatedayofyeardefinitiondialconvertdimensiondirectoriesdirnamedoydoy2dateexecutefileshex2iphex2nhexifyindexip2hexjdateleftlengthliteralloplowerlpadltrimmaximumminimimmjdmjd2datemodulusn2hexn2octaln2timenextfileoct2npathnamepatternpermissionsradixrandomrawcommandrdirectoriesrfilesreprepeatreplacereverserightrindexrpadrsearchsearchsizespansplitstripbstripnstripxsubstringtablelooktod2secstrimunhexifyupperverifywordI8IBaIK]IU`I__Ii5Ir+Ix/I{/I/I/II3II6I=4IM==SINIIOILIAICINJP>K>J JJJ!J')J.J4?7J;NJAJFJMJU9JYJ_Jd.JjJrJzQJ~RJJ>J?JW@?TJ@LVJJ2JJXJJDJ7JBJ@J K KK KKK$K)[K1ZK8K=,KBFKHKO:KV8K]Kg^ADUKqVKz-K*K KKEKZappendnewOO\v(home){%s} prescan: no memory for kermrc.kermrc=+--Extended argument errorinvalid argument bundlingmissing usernameusername too longmissing name in -y؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀À؀؀؀؀؀؀؀؀؀؀؀ـ؀؀؀؀_i؀؀؀؀؀}؀؀؀؀؀؀؀؀؀؀؀؀؀s؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀?Sorry, IKSD cannot CONNECT. Enter Client/Server Mode... Use: REMOTE LOGIN to log in to the server if necessary. SEND and GET for file transfer. REMOTE commands for file management. FINISH to terminate Client/Server mode. BYE to terminate and close connection. REMOTE HELP for additional information. _apc_commandsnone?Can't start command: %s ?Can't open file %s Can't open device %s Can't condition line ^C... ?Input error ?Can't transmit character ?Connection lost ?Output error Connection closed. Session Limit exceeded - closing connection. ?Communications error Can't TRANSMIT buffer ?Timeout ?Anonymous log creation not allowed Name of packet log filepacket.logName of session log filesession.logCX.LOGName of connection log file ?Unknown log designator - %d ?Sorry, %s is a directory name Disposition?%s - %s %02dtextbinaryunknown Transfer Bell: %s Transfer Interruption: %s Transfer Cancellation: %s Transfer CRC-calculation: %s Transfer Display: %s fullscreencrtbrief Transfer Locking-shift: forced%senableddisabled,%s%s not used Transfer Mode: %s automaticmanual Transfer Pipes: %s Transfer Protocol: %s Transfer Slow-start: %s 2H^ Connection type: %s Current flow-control: %s Defaults by connection type: %-14s: %s %-14s: (%d) Communications Parameters: Host: %s%s (reliable) %s: %s%s, speed: Line (closed)75/1200134.5%ld Mode: , mode: remote, modem: %s Parity: %s%shardware , stop-bits: (default), stop-bits: %d (8%c%d) (7%c%d) (8N%d) D, duplex: %s, halffullflow: %s, handshake: %d none offonauto Carrier-watch: %s, timeout: %d sec, timeout: none, close-on-disconnect: %s Lockfile: %s Secondary lockfile: %s Terminal bytesize: %d, escape character: %d (^%c) %20s %12s %12s %12s %12s Telnet OptionMe (client)U (client)Me (server)U (server)%20s UNKNOWN%12s %12s %12s %12s %20s %12s %12s %12s %12s WILLWONT؀؀ڀ؀ڀڀڀڀڀڀڀڀڀڀڀڀڀڀڀڀڀڀڀ؀؀ڀڀڀڀڀڀ؀ڀڀڀ؀ڀ؀؀؀ڀڀڀڀڀڀ؀؀ڀSET TELNET parameters: echo: %s NVT newline-mode: off (cr-nul)on (cr-lf)raw (cr)(lf) kermit: u, accepted; u, refused; u, requested; u, required; me, accepted; me, refused; me, requested; me, required; u, %sstartedstopped u, n/a me, %s; me, n/a; BINARY newline-mode: binary-mode: me, accepted; me, refused; u, %s; me, %s BINARYNVT binary-transfer-mode: %s bug binary-me-means-u-too: %s bug binary-u-means-me-too: %s bug sb-implies-will-do: %s terminal-type: TERMnone (%s will be used) րXHhxˀۀ؀ No networks are supported in this version of C-Kermit (none) \\%c\{%d} Dial status: %d Dial directory: %s (none) Dial directories: %2d. %s Dial method: auto defaultpulse tone Dial sort: %s Dial hangup: %s Dial display: %s on Dial retries: %-6d Dial interval: %d Dial retries: (auto) Dial interval: %d Dial timeout: %4d sec0 (auto) Redial number: %s Dial confirmation: %s Dial convert-directory: %s ask Dial ignore-dialtone: %s Dial pacing: %d Dial prefix: %s Dial suffix: %s Dial country-code: %-12sDial connect: %s %squietverbose Dial area-code: %-12sDial restrict: international long-distance local ? Dial lc-area-codes: %s Dial lc-prefix: %s Dial lc-suffix: %s Dial ld-prefix: %s Dial ld-suffix: %s Dial force-long-distance %s Dial intl-prefix: %s Dial intl-suffix: %s Dial toll-free-area-code: Dial pulse-countries: Dial tone-countries: Dial toll-free-prefix: %s Dial pbx-exchange: Dial pbx-inside-prefix: %s Dial pbx-outside-prefix: %s Dial macro: %s relative ?\fexec() too deeply nested %d%s*1 %lu%u%lx%lo0%lx\&%c[%d]%02d:%02d:%02d-2INTERNAL_ERRORARG_TOO_LONGARG_OUT_OF_RANGE%s<*>%d.%d.%d.%d00000000%02x%02x%02x%02x?%s €€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€|RRRR倃RRR,R&RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR&&&z|Sۀۀۀ||||||||||||||ɀ||z|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||zz R?ـՀՀՀkkW~߀#==#N#N#N!c!c#N#N#N""#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N#N,,/g,..//,,01=׀=׀=׀=׀227%7%8^=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀=׀8????./UNIXC-Kermitu3bfileevenmarkoddspaceimagelabeledmacbinary2480TMPDIRTEMPTMP/tmp/.%s%s|(default)rejectedNULL 8%c%d 7%c%d 8N%dGGGHJJJJJJG[IZI{JIHnJJI J;KgK€LVLLꀄLꀄLꀄLꀄLꀄLꀄKL LꀄK@L݀JLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄKπK〄LꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄLꀄKMP(P(P(P(P(P(P(P(M?MfMMMN&NsNOsOʀPPNPۀRQRRQ)RQ܀QQRwRQMQcQyQQcQSSfTTSsSTSSSSрST TbTTTTTTTTTTTTTTTTTTTTTSTTTTTTTTTTTTTTTTTTTTT(TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTETǀTԀTငUU#UPU}UU׀VV1V^VVV倄WW?WlXW쀄WŀXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWX؀XYu\YY'YNYŀYҀYZ9Z`ZZZ[[\ [ـ\)\\\\^I^I\\€]e^I]]]׀^I^I]^r^____________________________^^___________________________________^瀄_뀄_b_b_b_b_`$`1`X`e`b_``abbbbbbbbbbۀccSczcecȀcȀcȀcȀcȀcȀduddǀeeed䀄eeeee e0e]eeecdd d5d'dC?definition is circular or too deep \&a%s(\v(dir)) C-Kermit>(\v(dir)) IKSD>f0set parity mark, set dupl half, set handsh xon, set flow noneif def \%1 echo \%1, if not = \v(local) 0 hangup, stop 1 set win 4, set rec pack 2200, set prefix cautious`set win 4, set rec pack 1000, set prefixing cautiousset win 1, set rec pack 90, set prefixing all, set reliable off, set clearchannel off_assign _for\v(cmdlevel) { _getargs,define \\\%1 \feval(\%2),:_..top,if \%5 \\\%1 \%3 goto _..bot,\%6,:_..inc,incr \\\%1 \%4,goto _..top,:_..bot,_putargs},def break goto _..bot, def continue goto _..inc,do _for\v(cmdlevel) \%1 \%2 \%3 \%4 { \%5 },_assign _for\v(cmdlevel)0U΀D_assign _whi\v(cmdlevel) {_getargs,:_..inc,\%1,\%2,goto _..inc,:_..bot,_putargs},_def break goto _..bot, _def continue goto _..inc,do _whi\v(cmdlevel),_assign _whi\v(cmdlevel)`怑D_assign _sw_\v(cmdlevel) {_getargs,_forward \%1,\%2,:default,:_..bot,_putargs},_def break goto _..bot,do _sw_\v(cmdlevel),_assign _sw_\v(cmdlevel)(LD_assign _if\v(cmdlevel) {_getargs,\%1,_putargs},do _if\v(cmdlevel),_assign _if\v(cmdlevel)ЀDsuccesstimeoutinterruptedinternal errori/o errorhpxD/usr/local/doc//usr/share/lib//usr/share/doc//usr/local/lib//usr/local/share//usr/local/share/doc//usr/local/share/lib//usr/doc//opt//doc/܀쀑 .DZdjDK_INFO_DIRECTORYK_INFO_DIR/%s%sckermit2.txt%s%sckermit2.txt%skermit/%s%skermit/%s/%ld75/1200.5cmdini: no memory for INPUT bufferCan't allocate command buffers!cmdini: no memory for cmdstkcmdini: no memory for ifcmdcmdini: no memory for countcmdini: no memory for iftestcmdini: no memory for intimecmdini: no memory for inpcascmdini: no memory for takerrcmdini: no memory for merrorcmdini: no memory for xquietcmdini: no memory for kermrccmdini: no memory for apcbufcmdini: no memory for linecmdini: no memory for tmpbufCan't allocate macro buffers!ibm-linemodefatalfastcautiousrobust_forx_xif_while_switx\&@[%d]\&_[%d]=--+\%0r?%s - %s %s ?Memory allocation failure [getnct] %3d. %sWARNING: Last line of %s lacks terminator command filedirectory file?Line too long, maximum length: %d. %2d. File : %s (line %d) FORXIFWHILESWITCH %2d. Macro : %s 00. ERROR : Command source unknown %2d. Prompt: (top level) COMMAND PROMPT ************************* SEND-class command failed. Packets sent: %d Retransmissions: %d Timeouts: %d Transfer canceled by receiver. Receiver's message: "%s" Most recent local error: "%s" HINTS... If the preceding error message%s not explain the failure: s do does . Did you start a Kermit receiver on the far end? . Try changing the remote Kermit's FLOW-CONTROL setting. . Give me a SET FLOW XON/XOFF command and try again. . Give me a SET FLOW NONE command and try again. . Try it again with SET PREFIXING ALL. . Try it again with SET STREAMING OFF. . Try it again with SET RELIABLE OFF. . Try it again with SET CLEAR-CHANNEL OFF. . Try it again with SET PARITY SPACE. . %sive a ROBUST command and try again. As a last resort, gGAlso: . Be sure the source file has read permission. . Be sure the target directory has write permission. (Use SET HINTS OFF to suppress hints.) ************************* RECEIVE- or GET-class command failed. Packets received: %d Damaged packets: %d Packet length: %d Transfer canceled by sender. Sender's message: "%s" . Did you start a Kermit sender on the far end? . Choose a different FLOW-CONTROL setting and try again. . Try smaller packets (SET RECEIVE PACKET-LENGH). . Try a smaller window size (SET WINDOW). . As a last resort, give a ROBUST command and try again. . Give a ROBUST command and try again. . Try telling sender to SET PREFIXING ALL. . Try giving a ROBUST command to the sender. on_closeCommand file terminated by error. Command error: macro terminated. ?Error in TAKE command file: %s Memory allocation failureLine too long or contains NUL charactersCommand ?Invalid - "%s" Command stack: ?Invalid: %s Kermit command error in background execution%s555+Variable name(s)\fcontents(%s)\fdefinition(%s)?Failure to allocate storage for local variables?Connection %s %s is not open. toon?OUTPUT initialization error ?OUTPUT execution error %s, for%s Copyright (C) 1985, 2000, Trustees of Columbia University in the City of New York. Type ? or HELP for help. TEXTtextBINARYbinary>>> %s: "%s" >>> %s: (undef) ?addmmac malloc error: %s !addmmac internal error! ?addmac malloc error 2 addmac macro error 7: %s ?Macro table overflow ?addmac malloc error 3: %s ?addmac malloc error 5: %s _for_swi_whi[%d] -F: "%s" [%d] -M: "%s" ?Packet log wasn't open ?Session log wasn't open ?Connection log wasn't open ?Unexpected log designator - %d xǵ``00`offautomatic(unknown)\{%d}%c Versions: %s Numeric: %ld Built for: %s Patches: %s (none) %s for%s %s %s %s Terminal parameters: %19s: %1d%-12s %13s: %1d%-14s Bytesize: Command bitsTerminalTERM %19s: %-13s %13s: %-15s TypePrintEcholocalremoteLocking-shiftNewline-modeCr-displaycrlfnormaluncheckedAPCAutodownload %19s: %-13d %13s: %-15d HeightWidthDebugSession log CONNECT-mode escape character: %d (Ctrl-%c, %s): %s DEL %19s: %-13s Suspend Line: %s, Modem type: Communication device not yet selected with SET LINE Modem type: Set file type: %s Set file patterns: %s Maximum patterns allowed: %d File binary-patterns: File text-patterns: (none) {%s} %s Output pacing: %d (milliseconds) Output special-escapes: %s Input autodownload: %s Input cancellation: %s Input case: %s observeignore Input buffer-length: %d Input echo: %s Input silence: %d (seconds) Input timeout: %s quitproceed Last INPUT: -1 (INPUT command not yet given) Last INPUT: %d (%s) Array name?Bad array: %s Array not declared: %s Dimension = %d %3d. %s Declared arrays: \&%c[%d] No arrays declared Macro namePattern%s - not found Macros: No network support in this version of C-Kermit. %d Server timeout: %d Server idle-timeout: %d Server keepalive %s Server cd-message %s Server display: %s Server login: "%s", "%s", "%s" Server get-path: (none) %d. %s SUCCESSFAILURESorry, command disabled. Variable name or pattern* The following functions are available: \F() \v(%s) = Global variables: \%%%c No variables defined Macro arguments at level %d (\v(argc) = %d): (NULL) \%%%d = %s \&_[%d] = %s Top-level arguments (\v(argc) = %d): Type SHOW DIAL to see DIAL-related items. Type SHOW MODEM to see modem-related items. Command quoting: %s Take echo: %s Take error: %s Macro echo: %s Macro error: %s Quiet: %s Function diagnostics: %s Function error: %s Script echo: %s Command buffer length: %d Atom buffer length: %d File type: %s Terminal bytesize: %d Terminal echo: %s Transmit EOF: ^%c Transmit Fill: %d Transmit Fill: (none) Transmit Linefeed: %s Transmit Prompt: %d (%s) Transmit Prompt: (none) Transmit Echo: %s Transmit Locking-Shift: %s Transmit Pause: %d (millisecond%s) s Transmit Timeout: %d (second%s) Escape character: Ctrl-%c (ASCII %d, %s): %s , speed: unknownauto, carrier: %s, timeout: %d sec, timeout: noneType SHOW MODEM to see modem settings. Type SHOW COMMUNICATIONS to see modem signals. Character set translation is not supported in this version of C-Kermit Exit warning %s always Exit on-disconnect: %s Current exit status: %d Printer: %s%s | (default) Command autodownload: %s Command bytesize: %d bits Command recall-buffer-size: %d Command retry: %s Command interruption: %s Command quoting: %s Command more-prompting: %s Command height: %d Command width: %d Hints: %s Quiet: %s Maximum command length: %d Maximum number of macros: %d Macros defined: %d Maximum macro depth: %d Maximum TAKE depth: %d Suspend: %s Alarm at %s %s (no alarm set) send-list is empty %s, mode: %s, alias: %s Triggers: (none) Triggers: "%s" Most recent trigger encountered: "%s" Packet log: %s Session log: %s Connection log: %s Reliable: %s Clearchannel: %s Streaming: %s Streaming will be done if requested. Streaming will not be requested and will not be done. Streaming will be requested and will be done if the other Kermit agrees. Last transfer: %sstreaming%s, %ld cps. no , clearchannel --nointerrupts --bannerfile=%s (null) --cdfile:%s --cdmessage:%d --helpfile:%d --wtmplog:%d --wtmpfile=%s --anonymous:%d --privid:%d --permission:%04o --initfile:%s --userfile:%s --root:%s --xferlog=%d --xferfile=%s --timeout=%d --database=%d --dbfile=%s (db directory=[%s]) IKSD conf=%s CDPATH current directory: %s previous directory: %s cd path: %s cd message: %s server cd-message: %s cd message file: %s Nothing to show... 4/㠀4444㭀4L_)j着 ܹ!4܈纀S4}顀鵀̀>À4444d은4#4444440D툀O #44\e4"+Attributes: %s Blocksize: %s Date: %s Disposition: %s Encoding (Character Set): %s Length: %s Type (text/binary): %s System ID: %s System Info: %s Protection: %s %s = (null definition)invalid digit '%c' in number Invalid character '%c' in input  JJJJJJ.J.JJ#@extra characters after expression missing right parenthesis operator unexpected ?Array reference too long - %s ?Not an array - %s ?Invalid format for array name - %s ?No closing bracket on array dimension - %s ?Array dimension or subscript missing or not numeric ?Array dimension or subscript not positive or zero ?Not a variable name - %s ?Incomplete variable name - %s ?Only one character after '%%' in variable name, please ?Array subscript expected - %s ?Invalid array reference - %s ?Array not declared or subscript out of range \m(%s)Macros nested too deeply ?TAKE files and DO commands nested too deeply %0[%d] +M: "%s" \flit(Carriage return for home directory, or name of directory on this computerINPBUFSIZ=%dINBUFSIZE=%dOBUFSIZE=%dXFRCANPIPESENDCK_SPEEDCK_FASTCK_APCCK_AUTODLNOMKDIRMINIDIALWHATAMIDYNAMICCMDDEP=%dCKMAXPATH=%dCKMAXOPEN=%dZ_MAXCHAN=%dMAXGETPATH=%dCMDBL=%dVNAML=%dARRAYREFLEN=%dUIDBUFLEN=%dFORDEPTH=%dMAXTAKE=%dMACLEVEL=%dMAC_MAX=%dMAXWLD=%dMSENDMAX=%dMAXDDIR=%dMAXDNUMS=%dUNIXCK_TMPDIRNOFRILLSPARSENSETIMEHCK_NEED_SIGCK_TTYFDTNCODEIKS_OPTIONIKSDBIKSDCONFCK_LOGINCONGSPDNOSETBUFPATTERNSCKEXECNOKVERBSATTSVu3bu3b2__STDC____GNUC__CK_ANSICSIG_IUSE_MEMCPYHWPARITYCK_TTGWSIZCK_NAWSDCMDBUFCK_RECALLCK_TIMERSTTSPDLISTCK_PERMSCKTUNINGSTREAMINGUNPREFIXZEROCKREGEXZXREWINDCKFLOAT=%sdoubleMajor optional features included: External XYZMODEM protocol support RESEND command Control-character unprefixing Streaming Autodownload Major optional features not included: No fullscreen file transfer display No transaction log No debugging No built-in help No network support No Kerberos(TM) authentication No SRP(TM) (Secure Remote Password) protocol No Secure Sockets Layer (SSL) protocol No Transport Layer Security (TLS) protocol No encryption No X Windows forwarding Support for most modem types excluded No hardware flow control No character-set translation No SET KEY command No REDIRECT or PIPE command No pseudoterminal control None sysV3B2Target: %s GCC version: %s 2.3.3Compiled %s %s, options: Jan 10 200012:45:55byte order: %s endianlittlebigsizeofs: int=%ldlong=%ldshort=%ldchar=%ldchar*=%ldfloat=%lddouble=%ld/after/ask/before/dotfiles/except/heading/l/larger-than/list/log/noask/nodotfiles/noheading/nol/nolist/nolog/not-after/not-before/not-since/quiet/simulate/since/smaller-than/verbose +16=ITYahs ܊ܑܛ ܢܰ+1TYa܊ܰ/append/fromb64/swap-bytes/tob64DL+1TYa܊Uaܰ /as-name/binary/calibrate/command/delete/filenames/filter/image/move-to/pathnames/recover/recursive/rename-to/text  ! )4<CL܊W` kv /protocol  )4<CL@܊` kv cdctsdsrfilemodem-signalsri " "creationdeletionmodification=:=::=!read!writeappendhostlineportreadwrite$*18 =BGL!!=&&()<<===>>=||andasktimeoutabsolutealarmavailablebackgroundc-kermitcommandcountdefineddirectoryemulationequalerrorexistfailurefalseflagfloatforegroundiksdk-95lgtlltlocalmatchms-kermitnewernotnumericokopenorquietreadableremote-onlystarted-from-dialersuccesstapitruewildwriteable*&()  '&#!",1&0:@FLTZ _2ep3u-z ~ 0.'+$/%6!read-file!write-fileappend-fileconnectioncx-logdebug-logpacket-logread-filescreensession-logtransaction-logwrite-file   "a@'  cryptoencryptionk4k5kerberos4kerberos5krb4krb5ntlmsrpssltls  Variable name?Variable name required ?Read file not open ?Oops, no READ buffer! Prompt, enclose in { braces } to preserve leading and trailing spaces, precede question mark with backslash (\).?Timed out, assuming "No" Please respond Yes or No ?Timed out Please respond.by amount1?Variable %s not defined or not numeric Macro or variable name?Name too long: "%s" Text to be ignoredoperatorDefinition of variable?Argument vector array is read-only Definition of array elementDefinition of macro?%s failed ASSIGNDEFINEError - No phone number to convert %s%s%s%sError - prior SET DIAL COUNTRY-CODE command required Error - phone number ends prematurely: "%s" Error - No international dialing prefix defined %s%s%s%s%s%s%s%s%s%sWARNING - Prior SET DIAL AREA-CODE needed %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%srw Saving old directory as %s. Converting %s...; %s - Kermit dialing directory %-16s %-20s ; %5s %-6s ; %s ; NameNumberSpeedParityComment %-16s %-20s ; %5s %-6s %s OK Opening: %s... noneevenspacemarkodd ERROR: You seem to have old- and new-format entries mixed in your dialing directory. You'll have to edit it by hand to convert it to the new format. WARNING: Old-style dialing directory detected: %s Shall I convert it for you? Sorry, can't convert. Will ignore speed and parity fields, continuing... OK, will ignore speed and parity fields, continuing... ?internal error - ludial malloc 1 Warning: %d matches found, %d max ?internal error - ludial malloc 2 Lookup: "%s" - ambiguous%s - dialing skippedSorry, dialing is disabled. Please SET HOST first, and then SET MODEM TYPE Sorry, you must SET MODEM TYPE first Sorry, you must SET %s or SET HOST first LINE/dev/null Sorry, you must SET SPEED first timeout (seconds)0Number to dial or entry from dial directoryNumber to dial?Lookup what? %s ?No DIAL command given yet?You must specify a number to dial Lookup: "%s" - not found%s - dialing as given Lookup: fatal error - dialing skipped %s => %s ?Bad phone number WARNING - memory allocation failure: redial number Lookup: "%s" - exact match Lookup: "%s" - uniquely matches "%s" %d telephone number%sfound for "%s"%s s :.%3d. %-12s %-20s => %-20s (%d) (processing failed)And %d more... WARNING - No modem signals detected. Is your modem is turned on? If not, use Ctrl-C to interrupt dialing, turn on your modem, then %s.ANSWER againREDIALWARNING - SET FLOW RTS/CTS is in effect but modem's CTS signal is off. Disabling flow control temporarily %s... while waiting for callduring dialing Dial attempt %d of %d... Restricted: %s, skipping... Dialing %s Is this number correct? Please enter the correct number, or press Return to skip: Corrected phone number TESTING... Number: "%s" => "%s" Number: "%s" Will redial in %d second%s- press any key to redial immediately. Ctrl-C to cancel... %c?Not a regular file: "%s" ?Can't open file: "%s" %s: %d line%s s%s: %d match%s es/all/array/ascending/backup/brief/descending/directories/englishdate/files/isodate/message/nobackup/nomessage/nopage/norecursive/nosort/noxfermode/page/reverse/sort/xfermode  "   =I"*7 h!s#! ?K` Q ܛ ܢZ `ܰ$datenamesize,16DIRECTORY/DIRECTORIES/ALL/FILES/VERBOSE/BRIEF/PAGE/NOPAGE/ENGLISHDATE/ISODATE/DOTFILES/NODOTFILES/BACKUP/NOBACKUP/HEADING/NOHEADING/RECURSIVE/NORECURSIVE/XFERMODE/NOXFERMODE/NOSORT /SORT:NAME/SORT:SIZE/SORT:DATE/REVERSE/ASCENDING/NOMESSAGE/MESSAGE:{%s}(no options set)Switch?This switch does not take an argument ?This switch requires an argument Sort keyMessage to append to each line?This option can not be set }}ɀ}Ӏ}݀}怅}}~~D~~~~ƀ~р~~~.~9~#x~ۀ~怅~~ File specification; or switchFile specification*File size in bytes?Array name required Array name (a single letter will do)?Bad array name - "%s" File-time?Date-time required Pattern?Pattern required ?Sorry, not implemented yet - "%s" does not match switch or name of accessible filenot found or not accessible"%s" - %s ?Array declaration failure ?Empty directory - "%s" ?%s %s match - "%s" NoToo manydirectoriesfiles* Warning: Failure to allocate memory for sorting. * Will proceed without sorting... Directory of %s Files: %d 0000-00-00 00:00:00xxx%2d-%s-%4d %02d:%02d:%02d%10s%-10s %s %s%-10s %s %s%10s%10ld %s %s%10ld %s %s (T) (B) %s?Memory allocation error - try /NOSORT %ld director%s, %ld file%s, %ld byte%syies (%0.2fGB) (%0.2fMB) 瀅򀅄  ,86€̀؀䀅򀅅CQ^3 !3Au[Arguments for lsDirectory and/or file specificationCK_DIR%s %s?ELSE doesn't follow IF command to be ignoredClosing parenthesis?Closing parenthesis required _switx series of cases{ %s }?Unbalanced braces _switx?SWITCH macro definition gone! _forx initial value%dfinal value-1incrementCommand to execute_forx?FOR macro definition gone! ?Incomplete FOR command seconds to wait, or time of day hh:mm:ssseconds to pause, or time of day hh:mm:ssmilliseconds to sleep, or time of day hh:mm:ss100?Number, expression, or time of day required eventFilename?Wildcards not valid here modem signalSorry, arithmetic overflow - hh:mm:ss not usable on this platform. ?File does not exit: %s ?Can't get modification time: %s ?Can't return from level %d _xif_for_swi_whi<<< %s: "%s" <<< %s: (null) mode?Mode required ?Read file already open File to read?Input filename required ?Please specify a single file buffer size4096?Positive number required ?Can't allocate read buffer ?Read from pipe disabled System command to read from?Command name required ?Write to pipe disabled ?Write file already open System command to write toCan't open process for writing: %s Name of local file to create?Filename required ?Sorry, %s is a directory name ?Write/Append file already open ?Not implemented逅逅e<ۀ?@6MŀDvMŀMŀ8ڀMŀMŀMŀMŀ@MŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀDMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀC`MŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀDMŀHQMŀMŀMŀMŀMŀI〆MŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀMŀJsKLsCharacters to send at end of file, Use backslash codes for control characters?Too many characters, %d maximum Numeric code for blank-line fill characterNumeric code for host's prompt character, 0 for none10Number of milliseconds to pause between binary characters or text lines during transmissionSeconds to wait for each character to echoN׀OUOyNHOOgP P Type your escape character, %s, followed by X or E to cancel. > filename, | command, or type carriage return to confirm the command?"%s" has no effect in remote mode ?Not confirmed ?%s missing FilenameCommand?Access denied - %s ?Sorry, access to external commands is disabled. Hint: try again with an output redirector. ?No connection User ID?Internal error: malloc PasswordAccountUsername: ?Canceled Password: ?Parameter name required Remote directory nameName of remote file(s) to delete?Name of remote file(s) required Remote directory or file specificationCommand for remote systemConfirm, or remote directory nameRemote function invocationRemote variable name or functionQRemote variable nameAssignment for remote variableSName of remote file to copy?Name of remote file required Name of remote destination file or directory?Name of remote file or directory required Name of remote file to renameNew name of remote fileName of remote directory to createName of remote directory to delete?Name required ?Not implemented - %s b|]]^<^؀_e瀆e瀆e瀆e瀆e瀆e瀆e瀆ce瀆_ʀe瀆e瀆e瀆`Q`ad怆d怆e?File specification required File Attribute packetsSorry, command not available 132143142141135133139134145147?Not available jˀkjalрlрlрlрk5lрiiiil lрlojPositive numberSeconds of inactivity before INPUT failsNumber of bytes in INPUT bufferm^mn8nǀnـo#p^p^pBp^p^pP Closing connection on_closeMaking connections is disabled?Sorry, making connections is disabled Network connections not supported?%s Device name, or switchInternal error?Internal parsing error Timed out - no carrier?Timed out, no carrier. Try SET CARRIER OFF and SET LINE again, or else SET MODEM, SET LINE, and then DIAL. Access to lock deniedSorry, write access to UUCP lockfile directory denied. ************************* HINT (Use SET HINTS OFF to suppress future hints): Please read the installation instructions file, %sckuins.txt, or the UNIX appendix of the manual, "Using C-Kermit". ************************* Access to device deniedSorry, access to device denied: %s Device is in use or unavailableSorry, device is in use: %s Device open failedSorry, can't open connection: %sSorry, can't open connection: %s on_openNot implemented - %s AYour username, or "ftp", or "anonymous" Login cancelled anonymousftpEnter e-mail address as Password: Enter %s's Password: Enter Password: Login cancelled ~1~;~V~D~V~P̀׀Error number out of rangeModem signals unavailable in this version of Kermit No modem control for this device Modem signals unavailable Carrier Detect (CD): %s OnOff Dataset Ready (DSR): %s Clear To Send (CTS): %s Ring Indicator (RI): %s Data Terminal Ready (DTR): %s Request To Send (RTS): %s setgen: can't allocate memoryCK_NOPUSHHOSTmore? ?IKS idle timeout - Goodbye. Y or space-bar for yes, N for no _apc_commands^C...^C... suspend disabled %sJob control not supported Status report: file type: labeledimagebinary undefinedbinarytext file number size characters so far percent done block check: blank-free-2 block check compression 8th-bit prefixing locking shifts speed packet length window slotsCanceling batch, wait... Canceling batch... Canceling file, wait... Canceling file... Resending packet... hg||ʀ)))ʀghg||ʀ)hʀghg||ʀ)hʀgǀi6Type escape character (%s) followed by:X to cancel file, CR to resend current packetZ to cancel group, A for status reportE to send Error packet, Ctrl-C to quit immediately: Ctrl-C to cancel file transfer: Transfer interruption disabled. Sending: Receiving: => Size: %ld, Type: Size: unknown, Type: File Percent Packet Bytes Done CPS Length%c%9ld%5ld%%%8ld%8ld %c%9ld %8ld%8ld %s %sSENDRECV (%s) (%ld byte%s)s: OK (%d sec, %ld cps) [OK]: DISCARDED [discarded]: INTERRUPTED [interrupted]: SKIPPED [skipped]: ERROR: %s Error: Message: : REFUSED Refused: : INCOMPLETE [incomplete]*** screen() called with bad status ***%c SUMMARY: %ld file%s, %ld byte%s, %ld sec, %ld cps. ERROR: %s WARNING: %s %s: %ld*** screen() called with bad object ***XꀆV6Hр RTsɀ]Closing %s...OK on_closeon_exitERROR WRITING SESSION LOG, LOG CLOSED!  0ASdhlp  r+{4/var/log//iksd.db%s%s%s000000000000INIT7F000001%08lx:%010ld %s%08lx.%lx%s%siksd.lckr%s [cmdfile] [-x arg [-x arg]...[-yyy]..] [ = text ] ] -x is an option requiring an argument, -y an option with no argument. actions: -s files send files -r receive files -s - send from stdin -k receive files to stdout -x enter server mode -f finish remote server -g files get remote files from server (quote wildcards) -a name alternate file name, used with -s, -r, -g -c connect (before file transfer), used with -l and -b -n connect (after file transfer), used with -l and -b settings: -l dev communication line device -q quiet during file transfer -i binary file transfer -b bps line speed, e.g. 19200 -t half duplex, xon handshake -p x parity, x = e,o,m,s, or n -y name alternate init file name -Y no init file -e n receive packet length -w write over files -v n sliding window slots -z force foreground -m name modem type -R remote-only advisory If no action command is included, or -S is, enter interactive dialog. Type HELP OPTIONS at the prompt for further info. Ҁ%`瀒#Zۀ怒.P7u"%s" - %sUsage: +--invalid command-line option, type "%s -h" for helplocal action=%c No actions or connections allowed with -A-l or -j or -X required-a without -s, -r, or -gcan't change to '-a' directorywrite access to -a file deniedunredirected -k can only be used in local modeanonymousbannerfilecdfilecdmessagecdmsgdatabasedbfilehelpinitfilenointerruptsprividrootuserfilewtmpfilewtmplogxferfilexferlog( ((( ( ( ( ('(/(8(0123456789falsenooffokontrueyes "$&(*,. 069=@CH܀pxɤzz4쀆܀lDzǨ`ʤ׀:뀆$Extended option errorNo commands given for -Cinvalid argument bundlingmissing delay valuebad delay valueconflicting actionsinvalid argument bundling after -s-.No files for -s-s: too many -'sinvalid mixture of filenames and '-' in -ssending from terminal not allowedinvalid argument bundling after -gmissing filename for -ginvalid argument bundling after -amissing name in -ainvalid argument bundling after -ymissing filename in -yinvalid argument bundling after -l or -jcommunication line device name missing/dev/ttycan't open deviceon_openmissing bpsunsupported transmission rateinvalid argument bundling after -mmodem type missingunknown modem typeinvalid argument bundling after -emissing lengthUnsupported packet lengthmissing or bad window sizemissing parityinvalid paritymissing usernameinvalid command-line option, type "kermit -h" for help.ݒݒݒݒݒݒݒݒݒ Uݒݒݒݒݒݒݒݒܯ6̀ݒ(݈Ԉݒݒـݒ1x+ڀݒvݒݒݒݒݒݒݒݒݒ\݀ݒꀆΊ(/րݒ)Ե؀!ݒۋ耆r܊ݒ뀆1 ŀG[[[[[[[GRG[[[GUser Interface 7.0.222, 1 Jan 2000dbinary-patternssend-listtext-patterns(/off/on/redirect /binary/command/nowait/pipe/text/transparent ( !#.:@aboutaddanswerapcarrayasciiasgaskaskqassassertassignassociatebackbeepbinarybugbrowsebyeccdcgetcheckckermitclearcloseclscommentconnectcwddatedcldeclaredecrementdefinedeletedialdirectorydoeechoeightbitelseenableendevaluateexexecexitextended-optionsffailfifinishfoforforwardftpfunctionggegetgetcgotohhanguphelpiifiksdinincrementinputintrointroductionkermitlineoutlocallogloginlogoutminputmgetmkdirmmovemovempausemputmsmsendmsleepnewsnolocalnopushoopenoutputpausepdialpoppsendptypupurgepushputpwdqqueryquitrrasgrassignrcdrcopyrcwdrdeleterdirectoryreadreceiveredrediredialredoregetreinputremremoremoteremoveresreseresendresetretretrievereturnrexitrhelprhostrkermitrloginrmdirrmkdirrobustrpwdrqueryrrrrenamerrmdirrsetrspacertyperunrwhossavescscrscreenscriptsendserversetshshiftshowsortspacestastatstatisticsstatusstopsucceedsupportsuspendswitchtaketapitexttracetranslatetransmitundefineversionwaitwermitwherewhilewrwriwritwritewrite-linewritelnxifxlatexmitz^_asg_assign_decrement_define_evaluate_forward_getargs_increment_putargs*.?|q_s75677kt!%,025:\@~HNTBX*`hlqGuG};(2  <0h     HHi   $g)/.0+7<>-AFI9SY_l~s{}dml]PPP]{Dr0f 3%*,19=CHP[E`hSlSqSx}n8eeeCC $+15:<A)D)HO)V[bf io ty!"""1N$s%z?>~ IAAAA!a,a4J8>%CNEGXLXT_YgqzTU(!#.;:@^{nookyes(alarmask-timerattributesbbabackgroundbatchbaudbellblock-checkbufferscarrier-watchcaseclclecleaclear-channelclearchannelclose-on-disconnectcmdcommandconconsolecontrol-charactercountddedebugdefaultdelaydestinationdidiadisconnectduplexescape-characterf-ack-bugf-ack-pathfileflflagflow-controlhandshakehintsincompletellinelocal-echomacromodemoptionsparityportprefixingprotocolq8flagqnx-port-lockquietrecrecvreliablerepeatretry-limitserserialsession-logsleepspeedstartup-filestop-bitsstreamingteltelnettelopttemp-directoryterminaltransferwildcard-expansionwindow-sizexferKr "+3-303;3AFIKW2_.m72krdudydHd~ddo666'4T000 oxE,s6yAF I^N f[ ew< F k S vx}@N+DphML?q{? ` aOAV#n[#1hO+m5b<(?CCCJjQP`!i%/hr;$%>/(fcleolmove-toHpvascopyhostrename2h7 byconnectionscxpacketssession(append-filedebug-logerrorpacket-logsys$outputttrtratrantranstransatransactransacttransactitransactiotransactiontransaction-logtransactionsAH #',29AJT_k{bothdevicedevice-and-inputdevice-bufferdial-statusinput-buffer @H( !read!writeconnectioncx-logread-filewrite-filelry''x''( argargumentsargsarrayscharacter-setscomcommcommunicationscontrol-prefixingdouble/ignoreescapefeaturesfunctionsglobalsignore/doublelogsmacrosnetworkparameterspatternsprinterscriptsstacktriggervariables'@DNS 2<Z"imr"y>>* ;AN@*S24?56! ([  57?1C1J:` # ' , iA 3A> (>{allmailprinttypewho@,2h  DIVb y O T /after/array/as-name/b/before/c/calibrate/delete/dotfiles/except/filter/filenames/image/larger-than/listfile/move-to/nobackup/nodotfiles/not-after/not-before/pathnames/print/protocol/quiet/recover/recursive/rename-to/since/smaller-than/starting-at/subdirectories  $.:EQ\cmt}     "/listd:EQ\cmt   /quietly/triggerx/brief/verbose/count/head/match/more/nopage/page/prefix/tail/width ( assignmentscommand-level@ TYPE /PAGE/NOPAGE(no options set)/WIDTH:%dSwitch?This switch does not take an argument Column at which to truncate?Sorry, this option can not be set _array_x_Filename, or switchFile(s) to sendCommand?This switch does not take arguments ?This switch requires an argument ?Sorry, system command access is disabled ?Sorry, no SEND /COMMAND or CSEND when SEND FILTER selected Command, or switchPattern?Pattern required ?Pattern too long - 256 max device and/or directory for source file after sendingnew name for source file after sending%s ?Destination required?New name requiredSize in bytes0File date-time?Date-time required ?Sorry, sending files as mail is disabled e-mail address?address required ?Sorry, sending files for printing is disabled Print optionsName to send under?name required 0-based positionFile-transfer protocol?name of protocol required Filter program to send through?Filter must contain a replacement variable for filename. absoluteconvertednumber of Kbytes to send1024Name of file containing list of filenames?Filename required ?Wildcards not allowed Array name (a single letter will do)?Bad array: %s ?No such array: %s ?Unexpected switch value - %d ?Sorry, %s works only with Kermit protocol CSENDSEND /COMMAND?Sorry, no /RECOVER or /START if SEND FILTER selected ?%s - "%s" No files matchFile not found?Unexpected function code: %d ?Sorry, a command to send from is required ?Sorry, /DELETE conflicts with /MOVE or /RENAME ?Sorry, /MOVE-TO not available to guests ?Directory "%s" not found ?Sorry, /RENAME-TO not available to guests ?New name required for /RENAME ?/RENAME for file group must contain variables such as \v(filename) ?Sorry, /BINARY required ?Sorry, wildcards not permitted with /START ?Sorry, this command needs 32-bit integers ?Sorry, SEND /START works only with Kermit protocol Sorry, /RECOVER is possible only with Kermit or ZMODEM protocol ?Sorry, ATTRIBUTE DISPOSITION must be ON Sorry, you can only send one file at a time with XMODEM protocol Names of files to send, separated by spaces?MSEND list too long e-mail address (optional)e-mail address (required)printer options (optional) Optional as-name template containing replacement variables like \v(filename)Optional name to send it withCALIBRATION?Failure to open %s ?Filename required but not given ?Read access denied - "%s" ?Invalid switch combination ?As-name for file group must contain variables such as \v(filename) ?/STARTING-AT may not be used with multiple files. ?Bad array range - [%d:%d] ?A Kermit Server is unavailable to process this command. ?Start a RECEIVE command to complement this command. ?File deletion not allowed for guests. ߀㦀=""㦀po߀㜀Ѐ0߀߀""LqQQԀ=㦀ĀҀ?No switches match - "%s" String (enclose in braces if it contains spaces)?String required ?Too many patterns - %d is the maximum ?Sorry, REMOVE SEND-LIST not implemented yet. ?Sorry, ADD SEND-LIST does not work with external protocols File specification to add?A file specification is required WARNING - \v(filespec) buffer overflow type of file transfer As-name template containing replacement variables such as \v(filename)Name to send it withSorry, can't allocate space for as-nameSorry, can't allocate space for nameSorry, can't allocate file list nodedestroyresizeHqu`hbot( Array name?Array name required ?Segment notation not allowed in array declarations ?Memory allocation error Initial value for \&%c[%d]=Carriage return to confirm?Declare failed &%c[%d]Array initialization error: %s %s New size?New size required ?Bad array reference - "%s" ?Array not declared - "%s" ?Array segments not allowed for this operation ?Sorry, \&@[] is read-only Name of source arrayName of destination array?Partial arrays can not be destroyed ?Failed - destroy "\&%c[]" Value?Array %s is not declared Sorry, BYE only works with Kermit protocol ?A Kermit Server is unavailable to process this command %cText of comment line?Sorry, changing directories is disabled "CONNECTION", or log or file to close?You must say which file or log ?Connection was not open Variable name?Variable name required Integer arithmetic expression?Sorry, DEFINE/ASSIGN disabled ?Sorry, DIRECTORY is disabled optional return value ?No macros defined Macro?Macro name required optional argumentsbraced list of commands?Not a command or macro name: "%s" ?Not a command or macro name. ..tmp:%03dText to be echoedApplication Program Command text%s%c_%s%c\Text to be outputexit status codeOptional EXIT messageSorry, FINISH only works with Kermit protocol ?Sorry, reception of files is disabled label?Label name required Seconds to wait for input, or time of day hh:mm:ss?Number, expression, or time of day required Sorry, arithmetic overflow - hh:mm:ss not usable on this platform. List of input strings?Memory allocation failure Material to be input?INPUT timed out ?MINPUT timed out ?REINPUT failed What to log?Type of log required ?Already logged in ?No connection. expect-send expect-send ...?Sorry, CRECEIVE works only with Kermit protocol Sorry, REMOTE commands only work with Kermit protocol Remote Kermit server command?You must specify a command for the remote server ?Sorry, sending files is disabled Add to which list?Remove from which list?File to partially send?Sorry, wildcards not permitted in this command starting position (byte number)?Sorry, no PSEND while SEND FILTER selected Sorry, PSEND works only with Kermit protocol Sorry, SERVER only works with Kermit protocol optionkeymap?You must specify an option to save ?More fields required Parameter?You must specify a parameter to set ?Sorry, host command access is disabled Command to overlay C-Kermit or switchCommand to overlay C-Kermit?Command required ArgumentSystem command to execute?Sorry, SPACE command disabled Confirm for current disk, or specify a disk device or directory%s %sCarriage return, or optionMessage to print_xif_for_whi_swi%d?Sorry, IKSD can not be suspended ?Sorry, access to system is disabled ?Take files nested too deeply \v(home)C-Kermit command file?A file name is required ?Wildcards not allowed in command file name ?Can't execute a directory - "%s" Optional arguments%0File to transmit?Only a single file may be transmitted %s, for%s Numeric: %ld THIS IS A TEST VERSION, NOT FOR PRODUCTION USE. Patches: %s kermit command-line arguments, -h for helpkermit date and/or time, or carriage return for current File most recently... Sent: %s (none) Stored as: %s Received: %s If the full path is not shown, then the file is probably in your current directory or your download directory (if any - SHOW FILE to find out). pattern, or first few characters of a previous command*?Sorry, command recall can't be used now. %s%c?Sorry - "%s" not found %s SUCCESSFAILURENumber of arguments to shift1?Sorry, DELETE is disabled fastcautiousscreen actionRow (1-based)Column (1-based)?Row and Column must be 1 or greater Array operation?Sorry, not implemented yet - "%s" Trace object; Or switchTrace objectTRACE %s ONOFFRest of commandSorry, "%s" not configured in this version of Kermit. $A$$$J$$$9$J$AX XWڀX2XFXFX>iiìiii׀iiiCONNECT Command for UNIX:fork(), 7.0.104, 14 Nov 1999llmJmwmn ERROR: Failure to kill pid %d: %s, errno=%d (Back at %s) local UNIX system przqqq2qNqrqjo?setuid error - fatal Communications disconnect Connection closed due to telnet policy Connection closed by peer Remote Logout set proto %s, %s, set proto %sserverreceiveWARNING: Old CONNECT fork seems to be active. Attempting to remove it... Sorry, you must SET LINE first Sorry, you must SET SPEED first Sorry, CONNECT input buffer can't be allocated Sorry, CONNECT output buffer can't be allocated Sorry, CONNECT keyboard buffer can't be allocated Sorry, CONNECT temporary buffer can't be allocated Sorry, can't open %sConnecting to %s, speed %ld. The escape character is Ctrl-%c (ASCII %d, %s) DELType the escape character followed by C to get back, or followed by ? to see other options. . ESCAPE CHARACTER IS DISABLED (Session logged to %s, %s) binarytextDebugging Display...) ---------------------------------------------------- Sorry, can't condition console terminal Sorry, can't reopen %sSorry, Can't condition communication line ?Carrier required but not detected. *********************************** Hint: To CONNECT to a serial device that is not presenting the Carrier Detect signal, first tell C-Kermit to: SET CARRIER-WATCH OFF *********************************** Can't make pipeCan't make port fork Communications disconnect (Back at %s) Can't send characterWARNING: Failure to kill fork, pid %d: %s, errno=%d (Back at %s) ? for this message 0 (zero) to send a null B to send a BREAK L to send a Long BREAK U to hangup and close the connection Q to hangup and quit Kermit S for status ! to push to local shell Z to suspend \ backslash code: \nnn decimal character code \Onnn octal character code \Xhh hexadecimal character code terminate with carriage return. Type the escape character again to send the escape character, or press the space-bar to resume the CONNECT command. Ҁ递6_᐀ᭀᾀԀ?e⩀ ---------------------------------------------------- Press C to return to the C-Kermit prompt, or:Command>---------------------------------------------------- Hanging up %s: %sHostDeviceSpeed %ld Terminal echo: %slocalremote Terminal bytesize: %d Command bytesize: %d Parity: %s Autodownload: %sonoff Session log: %s(none) Elapsed time: %sError resuming CONNECT session %%%%%%%%%%%%%%%%%%%%%%%%%%%Ā%%%%%%%%%%%%%%v%%%%%%%%%%%%%%jĀ%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%j%%%%%%%뀇%%Ȁ%%%%Dial Command, 7.0.131, 22 Dec 19998 1313233352353354358394445464749耒ꀒ퀒 Any CCITT / ITU-T V.25bis conformant modem,:VALCRN%s CIC DIC l闀( Ȁ雀闀闀闀闀闀闀闀闀闀闀馀髀闀闀闀闀闀闀闀闀Hayes Smartmodem 2400 and compatiblesATP ATT ,ATQ0 OK ATD%s ATQ0H0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 Djo#tv|闀闀L+ꇀ闀闀闀闀闀闀闀ꏀꗀ闀闀Ꟁꥀꫀ걀귀꽀 `ɤUnknown%s X闀闀`闀闀闀闀闀闀闀闀闀闀闀闀闀闀闀闀闀闀(dummy)闀闀`闀闀闀闀闀闀闀闀闀闀闀闀闀闀闀闀闀闀Any ITU-T V.25ter/V.250 conformant modemATQ0X4 AT+IFC=2,2 AT+IFC=1,1 AT+IFC=0,0 AT+ES=3,0,2;+EB=1,0,30 AT+ES=0 AT+DS=3,0 AT+DS=0,0 씀jo#t|闀闀L+ꇀŀр݀递 ꏀꗀ闀闀Ꟁꥀꫀ걀귀꽀}ɤGeneric high-speed AT command setAT&F ATQ0H jo#t|闀闀L+܀闀闀闀闀闀闀闀ꏀꗀ闀闀Ꟁꥀꫀ걀귀꽀=ɤ鰀Ād䀒 ccitt-v25bisdirectgeneric-high-speedhhahayhayehayeshayes-2400itu-t-v250itu-t-v25ter/v250itu-t-v25bisnoneunknownuser-defined +%s(%s) %s %s T=DIAL H=%s D=%s N=%s O=%s LOGDIAL BUFFER OVERFLOW%s WARNING - speed change to %ld failed. Speed changed to %ld. PT@W;̀ր퀇2K_DIAL_DIRECTORYK_COUNTRYCODEK_LD_PREFIXK_INTL_PREFIXK_TF_PREFIXK_DIAL_METHODK_TF_AREACODE011800888877866199610119990000K_AREACODEK_PBX_OCPK_PBX_ICPK_PBX_XCH%s Failure: DIALANSWER%s: Timed out while trying to initialize modem. %s interval expired. DIAL TIMEOUTANSWER timeoutTimeout. Interrupted. "%c" Call not completed. Call did not come in. Error initializing modem. unknown ր DIAL command + phone number too long! atd%c%sSorry, Can't hang up communication device. Try 'set line %s' again. Initializing: %s... No response from modem, retrying%s... again No response from modem, retrying%s... WARNING - Trouble enabling error-correction. Likely cause: Your modem is an RPI model, which does not have built-in error correction and data compression.WARNING - You can't have compression without error correction. WARNING - Trouble enabling compression ATM1L%d%cATM0%cWARNING - I don't know how to enable autoanswer for this modem. ATS2=%dS7=%d ATS7=%d%c Dialing: %s... CNXINVCFIABAB: Timed outCBCB: Local DCE BusyETET: BusyNSNS: Number not storedNTNT: No answerRTRT: Ring tonePVPV: Parameter value errorPSPS: Parameter syntax errorMSMS: Message syntax errorCUCU: Command unknownFCFC: Forbidden callINCINC: Incoming callDLCDLC: Delayed callPROGRAM ERROR - No response handler for modem type %d WARNING: Carrier seems to have dropped... %sall complete: %s. Partial cC %sall complete: "%s". %sall complete. ߀Sorry, DIAL memory buffer can't be allocated Invalid modem type %d - internal error. Sorry, handler for this modem type not yet filled in. %sSorry, can't open %sSorry, can't open deviceSorry, can't reopen %sSorry, can't reopen device/dev/nullSorry, Can't condition communication line Try 'set line %s' again %s; Waiting for phone call... %srying: %s... Ret Via modem server: %s, modem: %s Device: %s, modem: %s, speed: %ld , speed: (unknown) ************************* HINT: interface speed %ld might be too high for this modem type. If dialing fails, SET SPEED to %ld or less and try again. (Use SET HINTS OFF to suppress future hints.) ************************* %s timeout: DialAnswer%d seconds (none) To cancel: type your interrupt character (normally Ctrl-C). OK OK ERROR ERROR at at AT AT Local phone is ringing! No Carrier. Modem Command Error. No Dialtone. Busy. No Answer. RELIABLE LAPM COMPRESSED )Ṽ̰ȀCCCONNECT Can't change speed to %ld Speed changed to %ld RRINGRINGINGDIALINGCONNECTOKNO CARRIERNO DIALTONENO DIAL TONEBUSYNO ANSWERVOICENO PROMPT TONEREMOTE ACCESS FAILEDFAXWAIT - CONNECTINGWAIT-CONNECTINGDELAYEDBLACKLISTEDCOMPRESSIONPROTOCOLDIAL LOCKEDRINGRING1RING2RING3ERRORCARRIERDATADIGITAL LINEDATETIMENAMENMBRMESG Modem hangup OK WARNING - modem hangup failed Hangup OK Hangup skipped Hangup errorScript Command, 7.0.030, 21 Oct 1998~ړړړړgړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړړ9ÀрړړړړړړړړړړړP ٕ"ړړ٬EOTBREAK\b\B{BREAK}Sorry, can't open %sExecuting SCRIPT through %s, speed %ld. Sorry, Can't condition communication line Script successful. Sorry, script failed Network support, 7.0.194, 30 Dec 1999Telnet support, 7.0.191, 30 Dec 1999EOFSUSPABORTEORSENOPDMARKBRKIPAOAYTECELGASBWILLWONTDODONTIAC "&,036:=@CFKPSXBINARYECHORCPSUPPRESS-GO-AHEADNAMESTATUSTIMING-MARKRCTENAOLNAOPNAOCRDNAOHTSNAOHTDNAOFFDNAOVTSNAOVTDNAOLFDEXTEND-ASCIILOGOUTBYTE-MACRODATA-ENTRY-TERMINALSUPDUPSUPDUP-OUTPUTSEND-LOCATIONTERMINAL-TYPEEND-OF-RECORDTACACS-UIDOUTPUT-MARKINGTTYLOC3270-REGIMEX.3-PADNAWSTSPEEDLFLOWLINEMODEXDISPLOCOLD-ENVIRONAUTHENTICATIONENCRYPTIONNEW-ENVIRONMENTTN3270EXAUTHCHARSETremote-serial-portCOM-PORT-CONTROLsuppress-local-echostart-tlskermitsend-urlforward-Xpragma-logonsspi-logonpragma-heartbeatibm-sakunknownҀ׀ހꀓ#*7>I]drɀрր݀〓쀓+39ATeyƀREFUSEDACCEPTEDREQUESTEDREQUIREDɀ0SYNCHEWRPLNEXTXONXOFFFORW1FORW2MCLMCRMCWLMCWRMCBOLMCEOLINSRTOVERECREWREBOLEEOL쀓,036 :=      " ' - 3 9 > B F KNULLKERBEROS_V4KERBEROS_V5SPXMINKSRPRSASSLIANA_8IANA_9LOKISSAKEA_SJKEA_SJ_INTEGDSSNTLM Ѐ Հ ဓ 퀓     - 1CLIENT_TO_SERVER|ONE_WAYSERVER_TO_CLIENT|ONE_WAYCLIENT_TO_SERVER|MUTUALSERVER_TO_CLIENT|MUTUALCLIENT_TO_SERVER|ONE_WAY|ENCRYPT_USING_TELOPTSERVER_TO_CLIENT|ONE_WAY|ENCRYPT_USING_TELOPTCLIENT_TO_SERVER|MUTUAL|ENCRYPT_USING_TELOPTSERVER_TO_CLIENT|MUTUAL|ENCRYPT_USING_TELOPTCLIENT_TO_SERVER|ONE_WAY|CRED_FWDSERVER_TO_CLIENT|ONE_WAY|CRED_FWDCLIENT_TO_SERVER|MUTUAL|CRED_FWDSERVER_TO_CLIENT|MUTUAL|CRED_FWDCLIENT_TO_SERVER|ONE_WAY|ENCRYPT_USING_TELOPT|CRED_FWDSERVER_TO_CLIENT|ONE_WAY|ENCRYPT_USING_TELOPT|CRED_FWDCLIENT_TO_SERVER|MUTUAL|ENCRYPT_USING_TELOPT|CRED_FWDSERVER_TO_CLIENT|MUTUAL|ENCRYPT_USING_TELOPT|CRED_FWDCLIENT_TO_SERVER|ONE_WAY|ENCRYPT_AFTER_EXCHANGESERVER_TO_CLIENT|ONE_WAY|ENCRYPT_AFTER_EXCHANGECLIENT_TO_SERVER|MUTUAL|ENCRYPT_AFTER_EXCHANGESERVER_TO_CLIENT|MUTUAL|ENCRYPT_AFTER_EXCHANGECLIENT_TO_SERVER|ONE_WAY|ENCRYPT_RESERVEDSERVER_TO_CLIENT|ONE_WAY|ENCRYPT_RESERVEDCLIENT_TO_SERVER|MUTUAL|ENCRYPT_RESERVEDSERVER_TO_CLIENT|MUTUAL|ENCRYPT_RESERVEDCLIENT_TO_SERVER|ONE_WAY|ENCRYPT_AFTER_EXCHANGE|CRED_FWDSERVER_TO_CLIENT|ONE_WAY|ENCRYPT_AFTER_EXCHANGE|CRED_FWDCLIENT_TO_SERVER|MUTUAL|ENCRYPT_AFTER_EXCHANGE|CRED_FWDSERVER_TO_CLIENT|MUTUAL|ENCRYPT_AFTER_EXCHANGE|CRED_FWDCLIENT_TO_SERVER|ONE_WAY|ENCRYPT_RESERVED|CRED_FWDSERVER_TO_CLIENT|ONE_WAY|ENCRYPT_RESERVED|CRED_FWDCLIENT_TO_SERVER|MUTUAL|ENCRYPT_RESERVED|CRED_FWDSERVER_TO_CLIENT|MUTUAL|ENCRYPT_RESERVED|CRED_FWD | ƀ ހ : g ؀  Q $ T ܀/Xʀ:mISSUPPORTREPLYSTARTENDREQUEST-STARTREQUEST-ENDENC-KEYIDDEC-KEYIDANYDES_CFB64DES_OFB64DES3_CFB64DES3_OFB64UNKNOWN-5UNKNOWN-6UNKNOWN-7CAST5_40_CFB64CAST5_40_OFB64CAST128_CFB64CAST128_OFB64 *4>HWft?Telnet waiting for response to WILL %s UNKNOWN?Telnet waiting for response to DO %s ?Telnet waiting for response to WONT %s ?Telnet waiting for response to DONT %s ?Telnet waiting for response to SB %s ?Telnet waiting for DO %s subnegotiation x Negotiations.. ?Telnet Protocol Timeout - connection closed ?Connection closed by peer. ?Telnet Option negotiation error. ?Connection closed by peer. (OK) {D𲀇ဇ>𲀇>tn_push called but not implemented - data lost. TELNET negotiation loop %s %sSAKTELNET SENT %s %sTELNET SENT SB %s FOLLOWS IAC SETELNET SENT SB %s SEND IAC SETELNET SENT SB %s IS %s IAC SETELNET SENT SB %s %sINFOSEND%02x USERVAR VAR VALUE ESC IAC %c IAC SETELNET SENT SB %s %02x IAC SÈ逈뀈iks_wait() me_iks_req_startiks_wait() me_iks_req_stopGlll 6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                     /dev/ttyDay Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/bin/shPATH:/bin:/usr/binsh7pwd 2>/dev/nullr/etc/utmp/etc/passwdrr===€=܀=쀓>>>(>:>L>\>o>>>>>ƀ>Ҁ>ހ>>???/?C?W?h?w?????Ѐ?܀?@@@2@N@g@v@@@@Հ@䀓AA"A+A4A=AUAlAAAAAɀAހA瀓ABBB$B>>>ހހvv΀րvWAGC0vv΀ր1WFFW`/Lw/K:/JMFw/GMT TZ/etc/utmp/dev/ ((((( H   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~CHRCLASSascii/lib/chrclass/@:'i _;U?3RE)?9p8)5D}[ % /-I /w5b6,6)d>a<M*N5[!kj@g#*)3)5T?=D=)3+DZ^?* n#%9XVY'A H0n:?vr'"Q"`(d+42M;C~:<q(Ff"7&>nG 978 5q5& 1Z$.H+tj']!6$J !w5%_^LKzaN } dP@ff&f&hQ!G+ A D )K m5\W?Y U?}F^ z!%ph]( Z(J9H/9!Y,DDM(L@(#)/lib/crt1.o.sl 1.3 4.1 04/24/86 61859 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/errno.h.sl 1.2 4.1 09/02/86 61183 AT&T-SF@(#)/usr/include/sys/errno.h.sl 1.4 3.1 06/02/86 54087 AT&T-SF@(#)/usr/include/sys/dir.h.sl 1.1 3.0 09/25/85 13771 @(#)/usr/include/sys/fs/s5dir.h.sl 1.2 3.0 11/06/85 10453 @(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/sys/stat.h.sl 1.3 3.0 12/19/85 41824 @(#)/usr/include/sys/file.h.sl 1.3 3.1 04/16/86 9268 AT&T-SF@(#)/usr/include/termio.h.sl 1.2 4.1 09/02/86 34662 AT&T-SF@(#)/usr/include/sys/termio.h.sl 1.2 3.1 04/16/86 26218 AT&T-SF@(#)/usr/include/sys/ioctl.h.sl 1.1 3.0 09/25/85 47484 @(#)/usr/include/fcntl.h.sl 1.2 4.1 09/02/86 59104 AT&T-SF@(#)/usr/include/sys/fcntl.h.sl 1.4 3.1 09/04/86 54191 AT&T-SF@(#)/usr/include/time.h.sl 1.4 4.1 09/02/86 40023 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/errno.h.sl 1.2 4.1 09/02/86 61183 AT&T-SF@(#)/usr/include/sys/errno.h.sl 1.4 3.1 06/02/86 54087 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/sys/dir.h.sl 1.1 3.0 09/25/85 13771 @(#)/usr/include/sys/fs/s5dir.h.sl 1.2 3.0 11/06/85 10453 @(#)/usr/include/pwd.h.sl 1.2 4.1 09/02/86 48003 AT&T-SF@(#)/usr/include/time.h.sl 1.4 4.1 09/02/86 40023 AT&T-SF@(#)/usr/include/sys/stat.h.sl 1.3 3.0 12/19/85 41824 @(#)/usr/include/sys/file.h.sl 1.3 3.1 04/16/86 9268 AT&T-SF@(#)/usr/include/fcntl.h.sl 1.2 4.1 09/02/86 59104 AT&T-SF@(#)/usr/include/sys/fcntl.h.sl 1.4 3.1 09/04/86 54191 AT&T-SF@(#)/usr/include/utmp.h.sl 1.2 4.1 09/02/86 55530 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/errno.h.sl 1.2 4.1 09/02/86 61183 AT&T-SF@(#)/usr/include/sys/errno.h.sl 1.4 3.1 06/02/86 54087 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/sys/utsname.h.sl 1.1 3.0 09/25/85 37228 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/errno.h.sl 1.2 4.1 09/02/86 61183 AT&T-SF@(#)/usr/include/sys/errno.h.sl 1.4 3.1 06/02/86 54087 AT&T-SF@(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/lib/libc.a/atol.o.sl 1.4 4.1 04/24/86 53759 AT&T-SF@(#)/lib/libc.a/chdir.o.sl 1.1 4.0 01/16/86 37805 AT&T-SF@(#)/lib/libc.a/chroot.o.sl 1.1 4.0 01/16/86 26301 AT&T-SF@(#)/lib/libc.a/crypt.o.sl 1.3 4.1 07/16/86 47988 AT&T-SF@(#)/lib/libc.a/ctermid.o.sl 1.1 4.0 01/16/86 37297 AT&T-SF@(#)/lib/libc.a/ctime.o.sl 1.6 4.1 07/16/86 57583 AT&T-SF@(#)/lib/libc.a/chmod.o.sl 1.1 4.0 01/16/86 37853 AT&T-SF@(#)/lib/libc.a/dup.o.sl 1.1 4.0 01/16/86 25981 AT&T-SF@(#)/lib/libc.a/dup2.o.sl 1.4 4.1 08/29/86 20110 AT&T-SF@(#)/lib/libc.a/execvp.o.sl 1.3 4.1 06/15/86 40277 AT&T-SF@(#)/lib/libc.a/fread.o.sl 1.5 4.1 08/06/86 6427 AT&T-SF@(#)/lib/libc.a/getcwd.o.sl 1.4 4.1 08/29/86 6283 AT&T-SF@(#)/lib/libc.a/getegid.o.sl 1.1 4.0 01/16/86 17860 AT&T-SF@(#)/lib/libc.a/geteuid.o.sl 1.1 4.0 01/16/86 20740 AT&T-SF@(#)/lib/libc.a/getgid.o.sl 1.1 4.0 01/16/86 54806 AT&T-SF@(#)/lib/libc.a/atoi.o.sl 1.4 4.1 04/24/86 53759 AT&T-SF@(#)/lib/libc.a/fseek.o.sl 1.1 4.0 01/16/86 26876 AT&T-SF@(#)/lib/libc.a/getlogin.o.sl 1.4 4.1 07/16/86 64898 AT&T-SF@(#)/lib/libc.a/fputs.o.sl 1.1 4.0 01/16/86 50668 AT&T-SF@(#)/lib/libc.a/getppid.o.sl 1.1 4.0 01/16/86 19716 AT&T-SF@(#)/lib/libc.a/getpwnam.o.sl 1.2 4.1 07/16/86 54032 AT&T-SF@(#)/lib/libc.a/getpwuid.o.sl 1.1 4.0 01/16/86 58506 AT&T-SF@(#)/lib/libc.a/getpwent.o.sl 1.2 4.1 08/06/86 55465 AT&T-SF@(#)/lib/libc.a/fgets.o.sl 1.2 4.1 07/16/86 57555 AT&T-SF@(#)/lib/libc.a/getuid.o.sl 1.1 4.0 01/16/86 35351 AT&T-SF@(#)/lib/libc.a/link.o.sl 1.1 4.0 01/16/86 37757 AT&T-SF@(#)/lib/libc.a/creat.o.sl 1.1 4.0 01/16/86 37790 AT&T-SF@(#)/lib/libc.a/errlst.o.sl 1.1 4.0 01/16/86 43171 AT&T-SF@(#)/lib/libc.a/popen.o.sl 1.4 4.1 08/29/86 11124 AT&T-SF@(#)/lib/libc.a/fcntl.o.sl 1.1 4.0 01/16/86 26317 AT&T-SF@(#)/lib/libc.a/fdopen.o.sl 1.2 4.1 06/15/86 26778 AT&T-SF@(#)/lib/libc.a/pipe.o.sl 1.1 4.0 01/16/86 17378 AT&T-SF@(#)/lib/libc.a/putenv.o.sl 1.1 4.0 01/16/86 11077 AT&T-SF@(#)/lib/libc.a/memccpy.o.sl 1.1 4.0 01/16/86 59532 AT&T-SF@(#)/lib/libc.a/rand.o.sl 1.3 4.1 07/16/86 9415 AT&T-SF@(#)/lib/libc.a/rew.o.sl 1.1 4.0 01/16/86 35152 AT&T-SF@(#)/lib/libc.a/scanf.o.sl 1.1 4.0 01/16/86 41570 AT&T-SF@(#)/lib/libc.a/doscan.o.sl 1.7 4.1 07/16/86 60596 AT&T-SF@(#)/lib/libc.a/atof.o.sl 1.6 4.1 07/16/86 7683 AT&T-SF@(#)/lib/libc.a/fdtos.o.sl 1.1 4.0 01/16/86 43457 AT&T-SF@(#)/lib/libc.a/filbuf.o.sl 1.1 4.0 01/16/86 51875 AT&T-SF@(#)/lib/libc.a/ptod.o.sl 1.4 4.1 08/29/86 34562 AT&T-SF@(#)/lib/libc.a/setbuf.o.sl 1.1 4.0 01/16/86 40863 AT&T-SF@(#)/lib/libc.a/setgid.o.sl 1.1 4.0 01/16/86 5833 AT&T-SF@(#)/lib/libc.a/setuid.o.sl 1.1 4.0 01/16/86 22228 AT&T-SF@(#)/lib/libc.a/sleep.o.sl 1.1 4.0 01/16/86 27946 AT&T-SF@(#)/lib/libc.a/alarm.o.sl 1.1 4.0 01/16/86 47639 AT&T-SF@(#)/lib/libc.a/pause.o.sl 1.1 4.0 01/16/86 26337 AT&T-SF@(#)/lib/libc.a/setjmp.o.sl 1.1 4.0 01/16/86 38006 AT&T-SF@(#)/lib/libc.a/sprintf.o.sl 1.1 4.0 01/16/86 19303 AT&T-SF@(#)/lib/libc.a/strchr.o.sl 1.1 4.0 01/16/86 52023 AT&T-SF@(#)/lib/libc.a/strcmp.o.sl 1.2 4.1 07/16/86 44085 AT&T-SF@(#)/lib/libc.a/strncpy.o.sl 1.2 4.1 06/15/86 14163 AT&T-SF@(#)/lib/libc.a/faddd.o.sl 1.1 4.0 01/16/86 59022 AT&T-SF@(#)/lib/libc.a/fcmpd.o.sl 1.1 4.0 01/16/86 40105 AT&T-SF@(#)/lib/libc.a/fdivd.o.sl 1.1 4.0 01/16/86 10630 AT&T-SF@(#)/lib/libc.a/fltod.o.sl 1.1 4.0 01/16/86 18580 AT&T-SF@(#)/lib/libc.a/fnegd.o.sl 1.1 4.0 01/16/86 37593 AT&T-SF@(#)/lib/libc.a/ldexp.o.sl 1.1 4.0 01/16/86 15998 AT&T-SF@(#)/lib/libc.a/fmuld.o.sl 1.3 4.1 07/16/86 50506 AT&T-SF@(#)/lib/libc.a/dround.o.sl 1.1 4.0 01/16/86 62856 AT&T-SF@(#)/lib/libc.a/dspecial.o.sl 1.1 4.0 01/16/86 7979 AT&T-SF@(#)/lib/libc.a/fpstart1.o.sl 1.2 4.1 06/15/86 19738 AT&T-SF@(#)/lib/libc.a/strtol.o.sl 1.6 4.1 07/16/86 31550 AT&T-SF@(#)/lib/libc.a/execl.o.sl 1.1 4.0 01/16/86 47265 AT&T-SF@(#)/lib/libc.a/execv.o.sl 1.1 4.0 01/16/86 65461 AT&T-SF@(#)/lib/libc.a/execve.o.sl 1.1 4.0 01/16/86 17110 AT&T-SF@(#)/lib/libc.a/exit.o.sl 1.1 4.0 01/16/86 52308 AT&T-SF@(#)/lib/libc.a/fork.o.sl 1.1 4.0 01/16/86 8429 AT&T-SF@(#)/lib/libc.a/strncat.o.sl 1.2 4.1 06/15/86 23221 AT&T-SF@(#)/lib/libc.a/time.o.sl 1.1 4.0 01/16/86 39659 AT&T-SF@(#)/lib/libc.a/time_comm.o.sl 1.8 4.1 01/30/87 25579 AT&T-SF@(#)/lib/libc.a/times.o.sl 1.1 4.0 01/16/86 26013 AT&T-SF@(#)/lib/libc.a/fopen.o.sl 1.2 4.1 08/29/86 10450 AT&T-SF@(#)/lib/libc.a/findiop.o.sl 1.1 4.0 01/16/86 36044 AT&T-SF@(#)/lib/libc.a/access.o.sl 1.1 4.0 01/16/86 25853 AT&T-SF@(#)/lib/libc.a/strlen.o.sl 1.1 4.0 01/16/86 64518 AT&T-SF@(#)/lib/libc.a/tolower.o.sl 1.4 4.1 04/24/86 57420 AT&T-SF@(#)/lib/libc.a/toupper.o.sl 1.4 4.1 04/24/86 57548 AT&T-SF@(#)/lib/libc.a/ttyslot.o.sl 1.2 4.1 06/15/86 20093 AT&T-SF@(#)/lib/libc.a/strncmp.o.sl 1.2 4.1 06/15/86 28844 AT&T-SF@(#)/lib/libc.a/strrchr.o.sl 1.1 4.0 01/16/86 63356 AT&T-SF@(#)/lib/libc.a/ttyname.o.sl 1.2 4.1 06/15/86 39588 AT&T-SF@(#)/lib/libc.a/fstat.o.sl 1.1 4.0 01/16/86 22233 AT&T-SF@(#)/lib/libc.a/lseek.o.sl 1.1 4.0 01/16/86 26177 AT&T-SF@(#)/lib/libc.a/stat.o.sl 1.1 4.0 01/16/86 22223 AT&T-SF@(#)/lib/libc.a/strcat.o.sl 1.1 4.0 01/16/86 27798 AT&T-SF@(#)/lib/libc.a/umask.o.sl 1.1 4.0 01/16/86 26285 AT&T-SF@(#)/lib/libc.a/uname.o.sl 1.1 4.0 01/16/86 24881 AT&T-SF@(#)/lib/libc.a/ungetc.o.sl 1.2 4.1 07/16/86 60367 AT&T-SF@(#)/lib/libc.a/unlink.o.sl 1.1 4.0 01/16/86 37773 AT&T-SF@(#)/lib/libc.a/utime.o.sl 1.1 4.0 01/16/86 26353 AT&T-SF@(#)/lib/libc.a/vfprintf.o.sl 1.1 4.0 01/16/86 31733 AT&T-SF@(#)/lib/libc.a/vprintf.o.sl 1.1 4.0 01/16/86 34757 AT&T-SF@(#)/lib/libc.a/vsprintf.o.sl 1.1 4.0 01/16/86 9222 AT&T-SF@(#)/lib/libc.a/doprnt.o.sl 1.1 4.0 01/16/86 32739 AT&T-SF@(#)/lib/libc.a/ctype.o.sl 1.3 4.1 08/29/86 37429 AT&T-SF@(#)/lib/libc.a/ecvt.o.sl 1.2 4.1 07/16/86 62646 AT&T-SF@(#)/lib/libc.a/dtop.o.sl 1.2 4.1 06/15/86 45240 AT&T-SF@(#)/lib/libc.a/biglitpow.o.sl 1.3 4.1 07/16/86 58018 AT&T-SF@(#)/lib/libc.a/frexp.o.sl 1.1 4.0 01/16/86 14207 AT&T-SF@(#)/lib/libc.a/fwrite.o.sl 1.5 4.1 08/06/86 53377 AT&T-SF@(#)/lib/libc.a/flsbuf.o.sl 1.2 4.1 06/15/86 45043 AT&T-SF@(#)/lib/libc.a/close.o.sl 1.1 4.0 01/16/86 43481 AT&T-SF@(#)/lib/libc.a/data.o.sl 1.1 4.0 01/16/86 48837 AT&T-SF@(#)/lib/libc.a/getenv.o.sl 1.1 4.0 01/16/86 12739 AT&T-SF@(#)/lib/libc.a/isatty.o.sl 1.2 4.1 06/15/86 29812 AT&T-SF@(#)/lib/libc.a/ioctl.o.sl 1.1 4.0 01/16/86 26189 AT&T-SF@(#)/lib/libc.a/ltostr.o.sl 1.3 4.1 07/16/86 47790 AT&T-SF@(#)/lib/libc.a/m32_data.o.sl 1.2 4.1 08/29/86 49169 AT&T-SF@(#)/lib/libc.a/malloc.o.sl 1.3 4.1 07/16/86 52312 AT&T-SF@(#)/lib/libc.a/memchr.o.sl 1.1 4.0 01/16/86 43452 AT&T-SF@(#)/lib/libc.a/memcpy.o.sl 1.1 4.0 01/16/86 41010 AT&T-SF@(#)/lib/libc.a/memset.o.sl 1.1 4.0 01/16/86 31300 AT&T-SF@(#)/lib/libc.a/open.o.sl 1.1 4.0 01/16/86 10730 AT&T-SF@(#)/lib/libc.a/read.o.sl 1.1 4.0 01/16/86 10714 AT&T-SF@(#)/lib/libc.a/sbrk.o.sl 1.1 4.0 01/16/86 30288 AT&T-SF@(#)/lib/libc.a/strcpy.o.sl 1.1 4.0 01/16/86 10565 AT&T-SF@(#)/lib/libc.a/wait.o.sl 1.1 4.0 01/16/86 31301 AT&T-SF@(#)/lib/libc.a/write.o.sl 1.1 4.0 01/16/86 10722 AT&T-SF@(#)/lib/libc.a/signal.o.sl 1.5 4.1 08/29/86 60416 AT&T-SF@(#)/lib/libc.a/fpstart.o.sl 1.1 4.0 01/16/86 31329 AT&T-SF@(#)/lib/libc.a/getflth0.o.sl 1.1 4.0 01/16/86 27494 AT&T-SF@(#)/lib/libc.a/getflts0.o.sl 1.2 4.1 07/16/86 32658 AT&T-SF@(#)/lib/libc.a/fpsetmask.o.sl 1.1 4.0 01/16/86 38940 AT&T-SF@(#)/lib/libc.a/kill.o.sl 1.1 4.0 01/16/86 5824 AT&T-SF@(#)/lib/libc.a/getpid.o.sl 1.1 4.0 01/16/86 18967 AT&T-SF@(#)/lib/libc.a/cerror.o.sl 1.1 4.0 01/16/86 56106 AT&T-SF@(#)/lib/crtn.o.sl 1.1 4.0 01/15/86 0 AT&T-SF